StarFunc result for job id Q5JSL3

User Input

>input (2073 residues)
MAEVRKFTKRLSKPGTAAELRQSVSEAVRGSVVLEKAKVVEPLDYENVIAQRKTQIYSDP
LRDLLMFPMEDISISVIGRQRRTVQSTVPEDAEKRAQSLFVKECIKTYSTDWHVVNYKYE
DFSGDFRMLPCKSLRPEKIPNHVFEIDEDCEKDEDSSSLCSQKGGVIKQGWLHKANVNST
ITVTMKVFKRRYFYLTQLPDGSYILNSYKDEKNSKESKGCIYLDACIDVVQCPKMRRHAF
ELKMLDKYSHYLAAETEQEMEEWLITLKKIIQINTDSLVQEKKETVETAQDDETSSQGKA
ENIMASLERSMHPELMKYGRETEQLNKLSRGDGRQNLFSFDSEVQRLDFSGIEPDIKPFE
EKCNKRFLVNCHDLTFNILGQIGDNAKGPPTNVEPFFINLALFDVKNNCKISADFHVDLN
PPSVREMLWGSSTQLASDGSPKGSSPESYIHGIAESQLRYIQQGIFSVTNPHPEIFLVAR
IEKVLQGNITHCAEPYIKNSDPVKTAQKVHRTAKQVCSRLGQYRMPFAWAARPIFKDTQG
SLDLDGRFSPLYKQDSSKLSSEDILKLLSEYKKPEKTKLQIIPGQLNITVECVPVDLSNC
ITSSYVPLKPFEKNCQNITVEVEEFVPEMTKYCYPFTIYKNHLYVYPLQLKYDSQKTFAK
ARNIAVCVEFRDSDESDASALKCIYGKPAGSVFTTNAYAVVSHHNQNPEFYDEIKIELPI
HLHQKHHLLFTFYHVSCEINTKGTTKKQDTVETPVGFAWVPLLKDGRIITFEQQLPVSAN
LPPGYLNLNDAESRRQCNVDIKWVDGAKPLLKIKSHLESTIYTQDLHVHKFFHHCQLIQS
GSKEVPGELIKYLKCLHAMEIQVMIQFLPVILMQLFRVLTNMTHEDDVPINCTMVLLHIV
SKCHEEGLDSYLRSFIKYSFRPEKPSAPQAQLIHETLATTMIAILKQSADFLSINKLLKY
SWFFFEIIAKSMATYLLEENKIKLPRGQRFPETYHHVLHSLLLAIIPHVTIRYAEIPDES
RNVNYSLASFLKRCLTLMDRGFIFNLINDYISGFSPKDPKVLAEYKFEFLQTICNHEHYI
PLNLPMAFAKPKLQRVQDSNLEYSLSDEYCKHHFLVGLLLRETSIALQDNYEIRYTAISV
IKNLLIKHAFDTRYQHKNQQAKIAQLYLPFVGLLLENIQRLAGRDTLYSCAAMPNSASRD
EFPCGFTSPANRGSLSTDKDTAYGSFQNGHGIKREDSRGSLIPEGATGFPDQGNTGENTR
QSSTRSSVSQYNRLDQYEIRSLLMCYLYIVKMISEDTLLTYWNKVSPQELINILILLEVC
LFHFRYMGKRNIARVHDAWLSKHFGIDRKSQTMPALRNRSGVMQARLQHLSSLESSFTLN
HSSTTTEADIFHQALLEGNTATEVSLTVLDTISFFTQCFKTQLLNNDGHNPLMKKVFDIH
LAFLKNGQSEVSLKHVFASLRAFISKFPSAFFKGRVNMCAAFCYEVLKCCTSKISSTRNE
ASALLYLLMRNNFEYTKRKTFLRTHLQIIIAVSQLIADVALSGGSRFQESLFIINNFANS
DRPMKATAFPAEVKDLTKRIRTVLMATAQMKEHEKDPEMLIDLQYSLAKSYASTPELRKT
WLDSMAKIHVKNGDFSEAAMCYVHVAALVAEFLHRKKLFPNGCSAFKKITPNIDEEGAMK
EDAGMMDVHYSEEVLLELLEQCVDGLWKAERYEIISEISKLIVPIYEKRREFEKLTQVYR
TLHGAYTKILEVMHTKKRLLGTFFRVAFYGQSFFEEEDGKEYIYKEPKLTGLSEISLRLV
KLYGEKFGTENVKIIQDSDKVNAKELDPKYAHIQVTYVKPYFDDKELTERKTEFERNHNI
SRFVFEAPYTLSGKKQGCIEEQCKRRTILTTSNSFPYVKKRIPINCEQQINLKPIDVATD
EIKDKTAELQKLCSSTDVDMIQLQLKLQGCVSVQVNAGPLAYARAFLNDSQASKYPPKKV
SELKDMFRKFIQACSIALELNERLIKEDQVEYHEGLKSNFRDMVKELSDIIHEQILQEDT
MHSPWMSNTLHVFCAISGTSSDRGYGSPRYAEV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2AF47	0.946	0.946	0.000	2073	0.966	0.966	A2AF47.pdb.gz	DOC11_MOUSE Dedicator of cytokinesis protein 11 OS=Mus musculus OX=10090 GN=Dock11 PE=1 SV=1
2	AFDB:Q8BIK4	0.790	0.796	0.000	2055	0.576	0.581	Q8BIK4.pdb.gz	DOCK9_MOUSE Dedicator of cytokinesis protein 9 OS=Mus musculus OX=10090 GN=Dock9 PE=1 SV=2
3	AFDB:Q8BZN6	0.855	0.826	0.000	2150	0.516	0.498	Q8BZN6.pdb.gz	DOC10_MOUSE Dedicator of cytokinesis protein 10 OS=Mus musculus OX=10090 GN=Dock10 PE=1 SV=4
4	AFDB:Q96HP0	0.595	0.601	0.000	2047	0.307	0.311	Q96HP0.pdb.gz	DOCK6_HUMAN Dedicator of cytokinesis protein 6 OS=Homo sapiens OX=9606 GN=DOCK6 PE=1 SV=3
5	AFDB:Q96N67	0.503	0.489	0.000	2140	0.317	0.307	Q96N67.pdb.gz	DOCK7_HUMAN Dedicator of cytokinesis protein 7 OS=Homo sapiens OX=9606 GN=DOCK7 PE=1 SV=4
6	AFDB:Q9BZ29	0.825	0.826	0.000	2069	0.590	0.592	Q9BZ29.pdb.gz	DOCK9_HUMAN Dedicator of cytokinesis protein 9 OS=Homo sapiens OX=9606 GN=DOCK9 PE=1 SV=2
7	AFDB:Q9VPI9	0.429	0.430	0.000	2064	0.309	0.311	Q9VPI9.pdb.gz	Q9VPI9_DROME LD20667p OS=Drosophila melanogaster OX=7227 GN=Zir PE=2 SV=2
8	AFDB:Q86I66	0.547	0.503	1.635E-92	2284	0.248	0.225	Q86I66.pdb.gz	Q86I66_DICDI DOCK family protein OS=Dictyostelium discoideum OX=44689 GN=zizA PE=3 SV=1
9	AFDB:Q54CA8	0.594	0.575	7.124E-82	2147	0.217	0.209	Q54CA8.pdb.gz	Q54CA8_DICDI DOCK family protein OS=Dictyostelium discoideum OX=44689 GN=zizB PE=3 SV=1
10	AFDB:Q8SAB7	0.433	0.481	2.190E-75	1830	0.208	0.236	Q8SAB7.pdb.gz	SPK1_ARATH Guanine nucleotide exchange factor SPIKE 1 OS=Arabidopsis thaliana OX=3702 GN=SPK1 PE=1 SV=1
11	PDB:6tgbA	0.240	0.305	5.100E-22	1450	0.080	0.114	6tgbA.pdb.gz
12	PDB:4a0cA	0.084	0.114	2.428E-5	1155	0.068	0.122	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
13	PDB:7mopA	0.118	0.105	3.523E-5	2445	0.065	0.055	7mopA.pdb.gz	Solenoid architecture of HUWE1 contributes to ligase activity and substrate recognition.
14	PDB:5itdA	0.064	0.125	4.906E-5	995	0.032	0.066	5itdA.pdb.gz	Discovery and Pharmacological Characterization of Novel Quinazoline-Based PI3K Delta-Selective Inhibitors.
15	PDB:7t3qA	0.068	0.067	6.033E-5	2103	0.087	0.086	7t3qA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
16	PDB:4yknA	0.063	0.101	7.119E-5	1205	0.033	0.056	4yknA.pdb.gz	Discovery of a Potent Class of PI3K alpha Inhibitors with Unique Binding Mode via Encoded Library Technology (ELT).
17	PDB:7mqaLM	0.096	0.097	7.119E-5	2041	0.050	0.051	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:3gb8A	0.074	0.131	7.734E-5	958	0.048	0.104	3gb8A.pdb.gz
19	PDB:3w3zA	0.086	0.140	9.511E-5	1013	0.050	0.103	3w3zA.pdb.gz	Structural basis for cell-cycle-dependent nuclear import mediated by the karyopherin Kap121p.
20	PDB:7t3rA	0.072	0.070	9.913E-5	2130	0.093	0.090	7t3rA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8YD85	0.0	2064	2199	0.518	0.488	A0A2R8YD85_HUMAN Dedicator of cytokinesis 10 OS=Homo sapiens OX=9606 GN=DOCK10 PE=1 SV=1
2	A2AF47	0.0	4211	2073	0.966	0.966	DOC11_MOUSE Dedicator of cytokinesis protein 11 OS=Mus musculus OX=10090 GN=Dock11 PE=1 SV=1
3	M9PCG3	0.0	1430	2298	0.402	0.363	M9PCG3_DROME Zizimin, isoform K OS=Drosophila melanogaster OX=7227 GN=Ziz PE=1 SV=1
4	Q5JSL3	0.0	4331	2073	1.000	1.000	DOC11_HUMAN Dedicator of cytokinesis protein 11 OS=Homo sapiens OX=9606 GN=DOCK11 PE=1 SV=2
5	Q8BIK4	0.0	2479	2055	0.582	0.587	DOCK9_MOUSE Dedicator of cytokinesis protein 9 OS=Mus musculus OX=10090 GN=Dock9 PE=1 SV=2
6	Q8BZN6	0.0	2069	2187	0.522	0.495	DOC10_MOUSE Dedicator of cytokinesis protein 10 OS=Mus musculus OX=10090 GN=Dock10 PE=1 SV=4
7	Q8R1A4	0.0	618	2130	0.189	0.184	DOCK7_MOUSE Dedicator of cytokinesis protein 7 OS=Mus musculus OX=10090 GN=Dock7 PE=1 SV=3
8	Q96BY6	0.0	2079	2186	0.525	0.498	DOC10_HUMAN Dedicator of cytokinesis protein 10 OS=Homo sapiens OX=9606 GN=DOCK10 PE=1 SV=3
9	Q96HP0	0.0	810	2047	0.293	0.297	DOCK6_HUMAN Dedicator of cytokinesis protein 6 OS=Homo sapiens OX=9606 GN=DOCK6 PE=1 SV=3
10	Q96N67	0.0	621	2140	0.188	0.182	DOCK7_HUMAN Dedicator of cytokinesis protein 7 OS=Homo sapiens OX=9606 GN=DOCK7 PE=1 SV=4
11	Q9BZ29	0.0	2526	2069	0.601	0.602	DOCK9_HUMAN Dedicator of cytokinesis protein 9 OS=Homo sapiens OX=9606 GN=DOCK9 PE=1 SV=2
12	Q9VPI9	0.0	630	2064	0.188	0.189	Q9VPI9_DROME LD20667p OS=Drosophila melanogaster OX=7227 GN=Zir PE=2 SV=2
13	Q8NF50	2.98e-178	599	2099	0.190	0.188	DOCK8_HUMAN Dedicator of cytokinesis protein 8 OS=Homo sapiens OX=9606 GN=DOCK8 PE=1 SV=3
14	Q8C147	9.32e-177	595	2100	0.190	0.188	DOCK8_MOUSE Dedicator of cytokinesis protein 8 OS=Mus musculus OX=10090 GN=Dock8 PE=1 SV=4
15	K7ESB7	1.01e-167	569	2082	0.190	0.189	K7ESB7_HUMAN Dedicator of cytokinesis 6 OS=Homo sapiens OX=9606 GN=DOCK6 PE=1 SV=2
16	Q86I66	1.69e-98	357	2284	0.106	0.096	Q86I66_DICDI DOCK family protein OS=Dictyostelium discoideum OX=44689 GN=zizA PE=3 SV=1
17	Q54CA8	1.85e-69	263	2147	0.072	0.069	Q54CA8_DICDI DOCK family protein OS=Dictyostelium discoideum OX=44689 GN=zizB PE=3 SV=1
18	Q8SAB7	9.10e-54	211	1830	0.088	0.099	SPK1_ARATH Guanine nucleotide exchange factor SPIKE 1 OS=Arabidopsis thaliana OX=3702 GN=SPK1 PE=1 SV=1
19	Q8CIQ7	1.49e-16	89.4	2027	0.041	0.041	DOCK3_MOUSE Dedicator of cytokinesis protein 3 OS=Mus musculus OX=10090 GN=Dock3 PE=1 SV=1
20	Q8IZD9	1.81e-16	89.0	2030	0.040	0.041	DOCK3_HUMAN Dedicator of cytokinesis protein 3 OS=Homo sapiens OX=9606 GN=DOCK3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06920 DHR-2_Lobe_A	3.3e-52	188.4	DHR-2, Lobe A
2	PF20422 DHR-2_Lobe_B	6.1e-26	101.7	DHR-2, Lobe B
3	PF20421 DHR-2_Lobe_C	6.4e-31	117.7	DHR-2, Lobe C
4	PF14429 DOCK-C2	1.2e-50	183.5	C2 domain in Dock180 and Zizimin proteins
5	PF11878 DOCK_C-D_N	1.6e-38	143.0	Dedicator of cytokinesis C/D, N terminal
6	PF00169 PH	1.7e-07	43.1	PH domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000276202

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000383118	0.976	Cell division control protein 42 homolog
2	9606.ENSP00000311135	0.819	Probable ATP-dependent RNA helicase DHX37
3	9606.ENSP00000262415	0.765	ATP-dependent RNA helicase DHX8
4	9606.ENSP00000367629	0.751	Rho guanine nucleotide exchange factor 16
5	9606.ENSP00000348461	0.726	Ras-related C3 botulinum toxin substrate 1
6	9606.ENSP00000256935	0.724	Dedicator of cytokinesis protein 2
7	9606.ENSP00000437775	0.698	BCL-6 corepressor-like protein 1
8	9606.ENSP00000228945	0.691	Rho GDP-dissociation inhibitor 2
9	9606.ENSP00000341524	0.651	Septin-6
10	9606.ENSP00000377944	0.635	U3 small nucleolar RNA-associated protein 14 homolog A
11	9606.ENSP00000252999	0.634	Laminin subunit alpha-5
12	9606.ENSP00000217909	0.632	Solute carrier family 25 member 43
13	9606.ENSP00000316729	0.629	Rho-related GTP-binding protein RhoJ
14	9606.ENSP00000267205	0.606	Rho-related GTP-binding protein RhoF
15	9606.ENSP00000238738	0.589	Rho-related GTP-binding protein RhoQ
16	9606.ENSP00000335655	0.563	Formin-like protein 3
17	9606.ENSP00000312185	0.556	Engulfment and cell motility protein 1
18	9606.ENSP00000308576	0.544	Rho-related GTP-binding protein RhoD
19	9606.ENSP00000428619	0.536	U3 small nucleolar RNA-associated protein 14 homolog C
20	9606.ENSP00000430276	0.528	Proto-oncogene DBL

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005085	0.992	guanyl-nucleotide exchange factor activity
GO:0019899	0.985	enzyme binding
GO:0031267	0.981	small GTPase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.980	biological regulation
GO:0009987	0.976	cellular process
GO:0050794	0.971	regulation of cellular process
GO:0050896	0.925	response to stimulus
GO:0043087	0.914	regulation of GTPase activity
GO:0048522	0.885	positive regulation of cellular process
GO:0044093	0.880	positive regulation of molecular function
GO:0032501	0.830	multicellular organismal process
GO:0043085	0.830	positive regulation of catalytic activity
GO:0048856	0.797	anatomical structure development
GO:0051345	0.781	positive regulation of hydrolase activity
GO:0030183	0.766	B cell differentiation
GO:0043547	0.729	positive regulation of GTPase activity
GO:0002260	0.717	lymphocyte homeostasis
GO:0002312	0.580	B cell activation involved in immune response
GO:0051128	0.502	regulation of cellular component organization
GO:0071840	0.392	cellular component organization or biogenesis
GO:0016043	0.354	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043227	0.982	membrane-bounded organelle
GO:0043229	0.979	intracellular organelle
GO:0043231	0.970	intracellular membrane-bounded organelle
GO:0070013	0.961	intracellular organelle lumen
GO:0005634	0.926	nucleus
GO:0031981	0.911	nuclear lumen
GO:0016020	0.828	membrane
GO:0005654	0.772	nucleoplasm
GO:0071944	0.453	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]