StarFunc result for job id Q5JSP0

User Input

>input (725 residues)
MESGRGSSTPPGPIAALGMPDTGPGSSSLGKLQALPVGPRAHCGDPVSLAAAGDGSPDIG
PTGELSGSLKIPNRDSGIDSPSSSVAGENFPCEEGLEAGPSPTVLGAHAEMALDSQVPKV
TPQEEADSDVGEEPDSENTPQKADKDAGLAQHSGPQKLLHIAQELLHTEETYVKRLHLLD
QVFCTRLTDAGIPPEVIMGIFSNISSIHRFHGQFLLPELKTRITEEWDTNPRLGDILQKL
APFLKMYGEYVKNFDRAVGLVSTWTQRSPLFKDVVHSIQKQEVCGNLTLQHHMLEPVQRV
PRYELLLKDYLKRLPQDAPDRKDAERSLELISTAANHSNAAIRKVEKMHKLLEVYEQLGG
EEDIVNPANELIKEGQIQKLSAKNGTPQDRHLFLFNSMILYCVPKLRLMGQKFSVREKMD
ISGLQVQDIVKPNTAHTFIITGRKRSLELQTRTEEEKKEWIQIIQATIEKHKQNSETFKA
FGGAFSQDEDPSLSPDMPITSTSPVEPVVTTEGSSGAAGLEPRKLSSKTRRDKEKQSCKS
CGETFNSITKRRHHCKLCGAVICGKCSEFKAENSRQSRVCRDCFLTQPVAPESTEKTPTA
DPQPSLLCGPLRLSESGETWSEVWAAIPMSDPQVLHLQGGSQDGRLPRTIPLPSCKLSVP
DPEERLDSGHVWKLQWAKQSWYLSASSAELQQQWLETLSTAAHGDTAQDSPGALQLQVPM
GAAAP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5JSP0	1.000	1.000	0.000	725	1.000	1.000	Q5JSP0.pdb.gz	FGD3_HUMAN FYVE, RhoGEF and PH domain-containing protein 3 OS=Homo sapiens OX=9606 GN=FGD3 PE=1 SV=1
2	AFDB:O88842	0.630	0.623	1.346E-85	733	0.756	0.748	O88842.pdb.gz	FGD3_MOUSE FYVE, RhoGEF and PH domain-containing protein 3 OS=Mus musculus OX=10090 GN=Fgd3 PE=1 SV=1
3	AFDB:Q7Z6J4	0.255	0.282	1.816E-48	655	0.350	0.388	Q7Z6J4.pdb.gz	FGD2_HUMAN FYVE, RhoGEF and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FGD2 PE=1 SV=1
4	AFDB:Q8BY35	0.254	0.281	4.563E-48	655	0.345	0.382	Q8BY35.pdb.gz	FGD2_MOUSE FYVE, RhoGEF and PH domain-containing protein 2 OS=Mus musculus OX=10090 GN=Fgd2 PE=1 SV=1
5	AFDB:O94887	0.377	0.269	7.343E-31	1054	0.210	0.144	O94887.pdb.gz	FARP2_HUMAN FERM, ARHGEF and pleckstrin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FARP2 PE=1 SV=3
6	AFDB:E9QIC8	0.372	0.271	4.529E-29	1025	0.188	0.133	E9QIC8.pdb.gz	E9QIC8_DANRE FERM, RhoGEF (ARHGEF) and pleckstrin domain protein 1 (chondrocyte-derived) OS=Danio rerio OX=7955 GN=farp1 PE=1 SV=1
7	AFDB:F1LYQ8	0.369	0.264	1.033E-28	1049	0.200	0.138	F1LYQ8.pdb.gz	FARP1_RAT FERM, ARHGEF and pleckstrin domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Farp1 PE=1 SV=2
8	AFDB:Q9TW28	0.264	0.134	7.045E-23	1737	0.149	0.062	Q9TW28.pdb.gz	MYOM_DICDI Myosin-M heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoM PE=1 SV=1
9	AFDB:Q9VS45	0.247	0.276	3.248E-21	647	0.141	0.158	Q9VS45.pdb.gz	Q9VS45_DROME LD03170p OS=Drosophila melanogaster OX=7227 GN=RhoGEF4 PE=2 SV=1
10	AFDB:Q54DW4	0.279	0.158	1.689E-20	1350	0.149	0.080	Q54DW4.pdb.gz	Q54DW4_DICDI Pleckstrin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=xacA PE=4 SV=1
11	PDB:7rx9A	0.271	0.435	1.273E-16	432	0.114	0.192	7rx9A.pdb.gz
12	PDB:4mt6A	0.282	0.444	8.038E-16	389	0.092	0.172	4mt6A.pdb.gz
13	PDB:4gouA	0.368	0.510	4.195E-11	507	0.074	0.107	4gouA.pdb.gz
14	PDB:3ljuX	0.142	0.258	4.419E-7	373	0.062	0.121	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
15	PDB:6u3eA	0.150	0.245	1.139E-5	397	0.073	0.134	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
16	PDB:6bbpA	0.118	0.160	1.195E-5	520	0.068	0.094	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
17	PDB:5yqrA	0.140	0.353	3.309E-5	268	0.034	0.093	5yqrA.pdb.gz
18	PDB:4mk0A	0.132	0.149	1.562E-4	631	0.051	0.059	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
19	PDB:6hhgA	0.117	0.214	2.934E-4	386	0.033	0.062	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
20	PDB:3pvuA	0.126	0.148	6.375E-4	609	0.044	0.053	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O88842	0.0	1091	733	0.754	0.746	FGD3_MOUSE FYVE, RhoGEF and PH domain-containing protein 3 OS=Mus musculus OX=10090 GN=Fgd3 PE=1 SV=1
2	P52734	0.0	603	960	0.466	0.352	FGD1_MOUSE FYVE, RhoGEF and PH domain-containing protein 1 OS=Mus musculus OX=10090 GN=Fgd1 PE=1 SV=2
3	P98174	0.0	595	961	0.461	0.348	FGD1_HUMAN FYVE, RhoGEF and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FGD1 PE=1 SV=2
4	Q5JSP0	0.0	1491	725	1.000	1.000	FGD3_HUMAN FYVE, RhoGEF and PH domain-containing protein 3 OS=Homo sapiens OX=9606 GN=FGD3 PE=1 SV=1
5	O88387	1.49e-176	525	766	0.383	0.363	FGD4_RAT FYVE, RhoGEF and PH domain-containing protein 4 OS=Rattus norvegicus OX=10116 GN=Fgd4 PE=1 SV=1
6	Q91ZT5	1.98e-175	523	766	0.382	0.362	FGD4_MOUSE FYVE, RhoGEF and PH domain-containing protein 4 OS=Mus musculus OX=10090 GN=Fgd4 PE=1 SV=1
7	Q96M96	4.96e-175	521	766	0.377	0.356	FGD4_HUMAN FYVE, RhoGEF and PH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=FGD4 PE=1 SV=2
8	Q7Z6J4	2.33e-162	485	655	0.343	0.380	FGD2_HUMAN FYVE, RhoGEF and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FGD2 PE=1 SV=1
9	Q8BY35	6.01e-154	463	655	0.338	0.374	FGD2_MOUSE FYVE, RhoGEF and PH domain-containing protein 2 OS=Mus musculus OX=10090 GN=Fgd2 PE=1 SV=1
10	Q49A55	9.59e-153	454	471	0.310	0.478	Q49A55_HUMAN FGD4 protein OS=Homo sapiens OX=9606 GN=FGD4 PE=1 SV=1
11	G5ECM5	4.63e-58	213	826	0.168	0.148	G5ECM5_CAEEL DH domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=exc-5 PE=1 SV=1
12	G5ED03	9.01e-58	213	844	0.168	0.145	G5ED03_CAEEL Putative Rho guanine nucleotide exchange factor FGD-1 OS=Caenorhabditis elegans OX=6239 GN=fgd-1 PE=2 SV=1
13	B7ZM68	8.72e-45	176	1178	0.214	0.132	B7ZM68_HUMAN FGD5 protein OS=Homo sapiens OX=9606 GN=FGD5 PE=1 SV=1
14	A0A2X0SFF2	2.68e-44	174	1462	0.217	0.107	A0A2X0SFF2_HUMAN FGD5 (Fragment) OS=Homo sapiens OX=9606 GN=FGD5 PE=4 SV=1
15	Q6ZNL6	2.68e-44	174	1462	0.217	0.107	FGD5_HUMAN FYVE, RhoGEF and PH domain-containing protein 5 OS=Homo sapiens OX=9606 GN=FGD5 PE=1 SV=3
16	Q54DW7	3.64e-33	139	986	0.156	0.115	Q54DW7_DICDI Pleckstrin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=gxcU PE=4 SV=1
17	Q91VS8	1.67e-30	131	1065	0.142	0.097	FARP2_MOUSE FERM, ARHGEF and pleckstrin domain-containing protein 2 OS=Mus musculus OX=10090 GN=Farp2 PE=1 SV=2
18	Q9Y4F1	1.14e-25	115	1045	0.123	0.085	FARP1_HUMAN FERM, ARHGEF and pleckstrin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FARP1 PE=1 SV=1
19	F1LYQ8	3.30e-25	114	1049	0.121	0.084	FARP1_RAT FERM, ARHGEF and pleckstrin domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Farp1 PE=1 SV=2
20	Q69ZK0	3.61e-25	114	1650	0.110	0.048	PREX1_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Mus musculus OX=10090 GN=Prex1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01363 FYVE	1.1e-08	46.4	FYVE zinc finger
2	PF02318 FYVE_2	16	17.1	FYVE-type zinc finger
3	PF16453 IQ_SEC7_PH	80	14.6	PH domain
4	PF00169 PH	2e-14	65.3	PH domain
5	PF16652 PH_13	7.6	17.9	Pleckstrin homology domain
6	PF17838 PH_16	86	14.4	PH domain
7	PF15410 PH_9	19	16.9	Pleckstrin homology domain
8	PF00621 RhoGEF	4.7e-43	159.0	RhoGEF domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364631

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000383118	0.929	Cell division control protein 42 homolog
2	9606.ENSP00000360021	0.812	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12
3	9606.ENSP00000364277	0.812	FYVE, RhoGEF and PH domain-containing protein 1
4	9606.ENSP00000382684	0.766	Melanocortin-2 receptor accessory protein
5	9606.ENSP00000297954	0.740	Serine/threonine-protein kinase WNK2
6	9606.ENSP00000298694	0.725	Rho guanine nucleotide exchange factor 40
7	9606.ENSP00000346667	0.723	Serine/threonine-protein kinase WNK3
8	9606.ENSP00000333821	0.651	Adrenocorticotropic hormone receptor
9	9606.ENSP00000364621	0.645	Sushi domain-containing protein 3
10	9606.ENSP00000380336	0.558	WD40 repeat-containing protein SMU1
11	9606.ENSP00000344961	0.542	Pleckstrin homology and RhoGEF domain containing G7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005085	1.000	guanyl-nucleotide exchange factor activity
GO:0005515	0.995	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0050794	0.992	regulation of cellular process
GO:0048583	0.982	regulation of response to stimulus
GO:0023051	0.969	regulation of signaling
GO:0051056	0.942	regulation of small GTPase mediated signal transduction
GO:0009987	0.934	cellular process
GO:0050896	0.435	response to stimulus
GO:0071840	0.362	cellular component organization or biogenesis
GO:0016043	0.337	cellular component organization
GO:0051716	0.309	cellular response to stimulus
GO:0048518	0.305	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043226	0.768	organelle
GO:0043229	0.758	intracellular organelle
GO:0043227	0.725	membrane-bounded organelle
GO:0043231	0.707	intracellular membrane-bounded organelle
GO:0016020	0.608	membrane
GO:0071944	0.516	cell periphery
GO:0005886	0.479	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]