StarFunc result for job id Q5JSQ8

User Input

>input (128 residues)
MAVGTSALSKEPWWTLPENFHSPMVFHMEEDQEELIFGLDDTYLRCIELHSHTLIQLERC
FTATGQTRVTVVGPPMAKQWLLLMFHCVGSQDSKCHARGLKMLERVRSQPLTNDDLVTSV
SLPPYTGD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0C7A0	0.818	0.830	8.113E-14	126	0.469	0.476	P0C7A0.pdb.gz	KHD1B_MOUSE KH homology domain-containing protein 1B OS=Mus musculus OX=10090 GN=Khdc1b PE=2 SV=1
2	AFDB:Q3UWR2	0.818	0.635	6.568E-13	166	0.469	0.361	Q3UWR2.pdb.gz	KHD1A_MOUSE KH homology domain-containing protein 1A OS=Mus musculus OX=10090 GN=Khdc1a PE=2 SV=1
3	AFDB:A6NGQ2	0.537	0.468	1.893E-4	149	0.211	0.181	A6NGQ2.pdb.gz	OOEP_HUMAN Oocyte-expressed protein homolog OS=Homo sapiens OX=9606 GN=OOEP PE=1 SV=3
4	AFDB:Q9CWE6	0.433	0.348	2.710E-4	164	0.148	0.116	Q9CWE6.pdb.gz	OOEP_MOUSE Oocyte-expressed protein homolog OS=Mus musculus OX=10090 GN=Ooep PE=1 SV=1
5	AFDB:Q9CQS7	0.432	0.463	4.117E-4	118	0.156	0.169	Q9CQS7.pdb.gz	DPA5A_MOUSE Developmental pluripotency-associated protein 5A OS=Mus musculus OX=10090 GN=Dppa5a PE=1 SV=2
6	AFDB:Q9XW13	0.419	0.130	1.071E-3	507	0.133	0.034	Q9XW13.pdb.gz	MXT_CAEEL Eukaryotic translation initiation factor 4E-binding protein Mextli homolog OS=Caenorhabditis elegans OX=6239 GN=mxt-1 PE=1 SV=1
7	AFDB:Q7KHL0	0.419	0.121	3.538E-3	508	0.117	0.030	Q7KHL0.pdb.gz	Q7KHL0_DROME Bancal protein OS=Drosophila melanogaster OX=7227 GN=HnRNP-K PE=2 SV=1
8	AFDB:Q587J8	0.550	0.339	3.756E-3	217	0.203	0.120	Q587J8.pdb.gz	KHDC3_HUMAN KH domain-containing protein 3 OS=Homo sapiens OX=9606 GN=KHDC3L PE=1 SV=1
9	AFDB:A0A0B4KGY6	0.347	0.076	4.233E-3	780	0.148	0.024	A0A0B4KGY6.pdb.gz	NOVA_DROME RNA-binding protein Pasilla OS=Drosophila melanogaster OX=7227 GN=ps PE=1 SV=1
10	AFDB:Q86TM3	0.383	0.089	4.770E-3	631	0.125	0.025	Q86TM3.pdb.gz	DDX53_HUMAN Probable ATP-dependent RNA helicase DDX53 OS=Homo sapiens OX=9606 GN=DDX53 PE=1 SV=3
11	PDB:6ke6RC	0.427	0.217	2.242E-2	278	0.102	0.047	6ke6RC.pdb.gz	3.4 angstrom cryo-EM structure of yeast 90S small subunit preribosome
12	PDB:6zqbJO	0.433	0.258	4.593E-2	236	0.102	0.055	6zqbJO.pdb.gz	90 S pre-ribosome transformation into the primordial 40 S subunit.
13	PDB:7mqaSW	0.357	0.248	8.862E-2	195	0.133	0.087	7mqaSW.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:6ql5I	0.374	0.036	9.407E-2	2036	0.062	0.004	6ql5I.pdb.gz	Discovery of a Regulatory Subunit of the Yeast Fatty Acid Synthase.
15	PDB:7mq8NY	0.433	0.219	9.407E-2	274	0.078	0.036	7mq8NY.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:7ajuJJ	0.328	0.229	9.987E-2	199	0.125	0.080	7ajuJJ.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
17	PDB:7pubFg	0.310	0.114	1.429E-1	513	0.125	0.031	7pubFg.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
18	PDB:5okzQ	0.297	0.217	2.447E-1	207	0.109	0.068	5okzQ.pdb.gz	Mpp6 Incorporation in the Nuclear Exosome Contributes to RNA Channeling through the Mtr4 Helicase.
19	PDB:7ajtCM	0.249	0.104	5.013E-1	360	0.070	0.025	7ajtCM.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
20	PDB:8b8jA	0.271	0.071	5.013E-1	709	0.125	0.023	8b8jA.pdb.gz	Structural basis for the activation of the lipid scramblase TMEM16F.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0C7A0	1.81e-38	128	126	0.477	0.484	KHD1B_MOUSE KH homology domain-containing protein 1B OS=Mus musculus OX=10090 GN=Khdc1b PE=2 SV=1
2	Q3UWR2	3.99e-36	123	166	0.461	0.355	KHD1A_MOUSE KH homology domain-containing protein 1A OS=Mus musculus OX=10090 GN=Khdc1a PE=2 SV=1
3	A6NGQ2	0.003	37.4	149	0.180	0.154	OOEP_HUMAN Oocyte-expressed protein homolog OS=Homo sapiens OX=9606 GN=OOEP PE=1 SV=3
4	Q9CWE6	0.087	33.5	164	0.141	0.110	OOEP_MOUSE Oocyte-expressed protein homolog OS=Mus musculus OX=10090 GN=Ooep PE=1 SV=1
5	Q8C753	1.5	30.8	1610	0.109	0.009	KATIP_MOUSE Katanin-interacting protein OS=Mus musculus OX=10090 GN=Katnip PE=1 SV=2
6	Q9C8N0	1.6	30.4	272	0.125	0.059	Q9C8N0_ARATH K+-H+ exchange-like protein OS=Arabidopsis thaliana OX=3702 GN=F22G10.1 PE=1 SV=1
7	Q9CQS7	1.9	29.6	118	0.141	0.153	DPA5A_MOUSE Developmental pluripotency-associated protein 5A OS=Mus musculus OX=10090 GN=Dppa5a PE=1 SV=2
8	Q9P896	7.4	28.5	682	0.109	0.021	TCSA_EMENI Two-component system protein A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=tcsA PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16005 MOEP19	1.4e-25	100.4	KH-like RNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359415

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000240189	0.717	PRAME family member 2
2	9606.ENSP00000380053	0.692	PRD class homeoboxes and pseudogenes
3	9606.ENSP00000272395	0.642	Tripartite motif containing 43
4	9606.ENSP00000423391	0.587	Ret finger protein like 4B
5	9606.ENSP00000480027	0.575	Belongs to the PRAME family
6	9606.ENSP00000334410	0.570	PRAME family member 14
7	9606.ENSP00000402414	0.566	Tripartite motif containing 48
8	9606.ENSP00000347211	0.559	PRAME family member 11
9	9606.ENSP00000321963	0.556	Zinc finger and SCAN domain-containing protein 4
10	9606.ENSP00000451411	0.529	Double homeobox 4 like 7
11	9606.ENSP00000485452	0.528	Double homeodomain protein DUX4-s
12	9606.ENSP00000350358	0.522	PRAME family member 12
13	9606.ENSP00000451207	0.520	Double homeobox 4 like 1
14	9606.ENSP00000458065	0.519	Double homeobox protein 4
15	9606.ENSP00000332134	0.517	PRAME family member 1
16	9606.ENSP00000335578	0.506	Arginine-fifty homeobox

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	0.999	RNA binding
GO:0042802	0.998	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0060255	0.997	regulation of macromolecule metabolic process
GO:0080090	0.984	regulation of primary metabolic process
GO:0010604	0.980	positive regulation of macromolecule metabolic process
GO:0051173	0.979	positive regulation of nitrogen compound metabolic process
GO:0050794	0.890	regulation of cellular process
GO:0031323	0.786	regulation of cellular metabolic process
GO:0048522	0.740	positive regulation of cellular process
GO:0031325	0.560	positive regulation of cellular metabolic process
GO:0019219	0.527	regulation of nucleobase-containing compound metabolic process
GO:0030162	0.514	regulation of proteolysis
GO:0065009	0.507	regulation of molecular function
GO:0052547	0.502	regulation of peptidase activity
GO:0051345	0.500	positive regulation of hydrolase activity
GO:0051247	0.481	positive regulation of protein metabolic process
GO:0052548	0.472	regulation of endopeptidase activity
GO:0010952	0.464	positive regulation of peptidase activity
GO:0010950	0.454	positive regulation of endopeptidase activity
GO:2000116	0.376	regulation of cysteine-type endopeptidase activity
GO:0043280	0.310	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0048583	0.302	regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043227	0.854	membrane-bounded organelle
GO:0043231	0.797	intracellular membrane-bounded organelle
GO:0005634	0.789	nucleus
GO:0031981	0.356	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]