StarFunc result for job id Q5JSZ5

User Input

>input (2229 residues)
MSDRLGQITKGKDGKSKYSTLSLFDKYKGKSVDAIRSSVIPRHGLQSLGKVAAARRMPPP
ANLPSLKSENKGNDPNIVIVPKDGTGWANKQDQQDPKSSSATASQPPESLPQPGLQKSVS
NLQKPTQSISQENTNSVPGGPKSWAQLNGKPVGHEGGLRGSSRLLSFSPEEFPTLKAAGG
QDKAGKEKGVLDLSYGPGPSLRPQNVTSWREGGGRHIISATSLSTSPTELGSRNSSTGDG
APSSACTSDSKDPSLRPAQPVRKGASQFMGNVYHPPTYHDMLPAFMCSPKSSENQGTVER
GSFPLPQLRLEPRVPFRQFQMNDQDGKENRLGLSRPLRPLRQLVERAPRPTIINAENLKG
LDDLDADADDGWAGLHEEVDYSEKLKFSDDEEEEEVVKDGRPKWNSWDPRRQRQLSMSSA
DSADAKRTREEGKDWAEAVGASRVVRKAPDPQPPPRKLHGWAPGPDYQKSSMGSMFRQQS
IEDKEDKPPPRQKFIQSEMSEAVERARKRREEEERRAREERLAACAAKLKQLDQKCKQAR
KAGEARKQAEKEVPWSPSAEKASPQENGPAVHKGSPEFPAQETPTTFPEEAPTVSPAVAQ
SNSSEEEAREAGSPAQEFKYQKSLPPRFQRQQQQQQQEQLYKMQHWQPVYPPPSHPQRTF
YPHHPQMLGFDPRWMMMPSYMDPRITPTRTPVDFYPSALHPSGLMKPMMPQESLNGTGCR
SEDQNCVPPLQERKVTPIDSPPVWSPEGYMALQSKGYPLPHPKSSDTLAMDMRVRNESSF
SASLGRAGGVSAQRDLFEERGEEYLSAFDKKAQADFDSCISSQRIGQELLFPPQENVQDA
GAPGGHTQNLRCSPLEPDFVPDEKKPECGSWDVSHQPETADTAHGVERETPREGTAFNIS
SWDKNGSPNKQPSSEPEWTPEPRSSSSQHPEQTGRTRRSGPIKKPVLKALKVEDKEKELE
KIKQELGEESTRLAKEKEQSPTAEKDEDEENDASLANSSTTTLEDKGPGHATFGREATKF
EEEEKPDKAWEARPPRESSDVPPMKRNNWIFIDEEQAFGVRGQARGRGRGFREFTFRGRP
AGGNGSGLCGGGVLGARSIYCSSQRSGRGRGLREFARPEDCPRAKPRRRVASETHSEGSE
YEELPKRRRQRGSENGNEGSLLEREESTLKKGDCRDSWRSNKGCSEDHSGLDAKSRGPRA
FGRALPPRLSNCGYGRRTFVSKESPHWQSKSPGSSWQEYGPSDTCGSRRPTDRDYVPDSY
RHPDAFGGRGFEDSRAEDKRSFFQDEHVADSENAENRPFRRRRPPRQDKPPRFRRLRQER
ESLGLWGPEEEPHLLAGQWPGRPKLCSGDKSGTVGRRSPELSYQNSSDHANEEWETASES
SDFSERRERREGPGSEPDSQVDGGLSGASLGEKKELAKRSFSSQRPVVDRQSRKLEPGGF
GEKPVRPGGGDTSPRYESQQNGTPLKVKRSPDEALPGGLSGCSSGSGHSPYALERAAHAS
ADLPEASSKKAEKEAKLAAPRAGEQGEAMKQFDLNYGSAIIENCGSSPGEESEVGSMVGE
GFIEVLTKKQRRLLEEERRKKEQAVQVPVKGRGLSSRIPPRFAKKQNNLCLEQGDVTVPG
SSLGTEIWESSSQALPVQAPANDSWRKAVTAFSSTETGSAEQGFKSSQGDSGVDLSAESR
ESSATSSQRSSPYGTLKPEEMSGPGLAEPKADSHKEQAPKPSEQKDSEQGSGQSKEHRPG
PIGNERSLKNRKGSEGAERLQGAVVPPVNGVEIHVDSVLPVPPIEFGVSPKDSDFSLPPG
SASGPTGSPVVKLQDALASNAGLTQSIPILRRDHHIQRAIGLSPMSFPTADLTLKMESAR
KAWENSPSLPEQSSPGGAGSGIQPPSSVGASSGVNYSSFGGVSMPPMPVASVAPSASMPG
SHLPPLYLDGHVFASQPRLVPQTIPQQQSYQQAAAAQQIPISLHTSLQAQAQLGLRGGLP
VSQSQEIFSSLQPFRSQVYMHPSLSPPSTMILSGGTALKPPYSAFPGMQPLEMVKPQSGS
PYQPMSGNQALVYEGQLSQAAGLGASQMLDSQLPQLTMPLPRYGSGQQPLILPQSIQLPP
GQSLSVGAPRRIPPPGSQPPVLNTSREPSQMEMKGFHFADSKQNVPSGGPVPSPQTYRPS
SASPSGKPSGSAVNMGSVQGHYVQQAKQRVDEKPSLGAVKLQEAPSAASQMKRTGAIKPR
AVKVEESKA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5JSZ5	1.000	1.000	0.000	2229	1.000	1.000	Q5JSZ5.pdb.gz	PRC2B_HUMAN Protein PRRC2B OS=Homo sapiens OX=9606 GN=PRRC2B PE=1 SV=2
2	AFDB:Q7TPM1	0.049	0.066	0.000	1486	0.578	0.867	Q7TPM1.pdb.gz	PRC2B_MOUSE Protein PRRC2B OS=Mus musculus OX=10090 GN=Prrc2b PE=1 SV=1
3	AFDB:P48634	0.041	0.042	1.033E-37	2157	0.305	0.315	P48634.pdb.gz	PRC2A_HUMAN Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A PE=1 SV=3
4	AFDB:Q9VU86	0.038	0.043	2.295E-5	1873	0.108	0.129	Q9VU86.pdb.gz	Q9VU86_DROME LD34837p OS=Drosophila melanogaster OX=7227 GN=Spt20 PE=1 SV=3
5	AFDB:Q1G7G9	0.036	0.041	1.409E-4	1523	0.096	0.140	Q1G7G9.pdb.gz	TALD3_CHICK TALPID3 protein OS=Gallus gallus OX=9031 GN=TALPID3 PE=2 SV=2
6	AFDB:P18160	0.038	0.036	2.952E-4	2410	0.111	0.102	P18160.pdb.gz	SPLA_DICDI Dual specificity protein kinase splA OS=Dictyostelium discoideum OX=44689 GN=splA PE=1 SV=3
7	AFDB:Q8IY92	0.026	0.029	3.611E-4	1834	0.115	0.140	Q8IY92.pdb.gz	SLX4_HUMAN Structure-specific endonuclease subunit SLX4 OS=Homo sapiens OX=9606 GN=SLX4 PE=1 SV=3
8	AFDB:M9PGC5	0.044	0.041	4.418E-4	2462	0.126	0.114	M9PGC5.pdb.gz	WNK_DROME Serine/threonine-protein kinase Wnk OS=Drosophila melanogaster OX=7227 GN=Wnk PE=1 SV=2
9	AFDB:P34706	0.033	0.034	4.418E-4	2150	0.068	0.071	P34706.pdb.gz	SDC3_CAEEL Zinc finger protein sdc-3 OS=Caenorhabditis elegans OX=6239 GN=sdc-3 PE=1 SV=2
10	AFDB:Q9BVV6	0.032	0.040	4.418E-4	1533	0.098	0.143	Q9BVV6.pdb.gz	TALD3_HUMAN Protein TALPID3 OS=Homo sapiens OX=9606 GN=KIAA0586 PE=1 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5JSZ5	0.0	4512	2229	1.000	1.000	PRC2B_HUMAN Protein PRRC2B OS=Homo sapiens OX=9606 GN=PRRC2B PE=1 SV=2
2	Q7TPM1	0.0	1191	1486	0.276	0.415	PRC2B_MOUSE Protein PRRC2B OS=Mus musculus OX=10090 GN=Prrc2b PE=1 SV=1
3	A0A1U9X974	1.87e-84	312	2157	0.110	0.114	A0A1U9X974_HUMAN PRRC2A OS=Homo sapiens OX=9606 PE=4 SV=1
4	P48634	1.87e-84	312	2157	0.110	0.114	PRC2A_HUMAN Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A PE=1 SV=3
5	E7EPN9	3.76e-60	233	2819	0.096	0.076	E7EPN9_HUMAN Proline rich coiled-coil 2C OS=Homo sapiens OX=9606 GN=PRRC2C PE=1 SV=1
6	Q9Y520	2.32e-58	227	2896	0.097	0.075	PRC2C_HUMAN Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C PE=1 SV=4
7	Q3TLH4	1.50e-57	224	2846	0.098	0.077	PRC2C_MOUSE Protein PRRC2C OS=Mus musculus OX=10090 GN=Prrc2c PE=1 SV=3
8	M9PE74	4.28e-04	48.1	2305	0.014	0.013	M9PE74_DROME No circadian temperature entrainment, isoform D OS=Drosophila melanogaster OX=7227 GN=nocte PE=1 SV=1
9	Q9W2U7	4.28e-04	48.1	2309	0.014	0.013	Q9W2U7_DROME LP18708p OS=Drosophila melanogaster OX=7227 GN=nocte PE=1 SV=4
10	Q2KIQ2	0.94	37.0	495	0.020	0.091	MNS1_BOVIN Meiosis-specific nuclear structural protein 1 OS=Bos taurus OX=9913 GN=MNS1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07001 BAT2_N	1.4e-58	210.1	BAT2 N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000349856

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000429931	0.878	Eukaryotic translation initiation factor 3 subunit H
2	9606.ENSP00000431800	0.776	Eukaryotic translation initiation factor 3 subunit F
3	9606.ENSP00000346466	0.747	WD repeat-containing protein 91
4	9606.ENSP00000362688	0.735	Eukaryotic translation initiation factor 3 subunit I
5	9606.ENSP00000360938	0.704	Sarcosine dehydrogenase, mitochondrial
6	9606.ENSP00000301067	0.694	Histone-lysine N-methyltransferase 2D
7	9606.ENSP00000380793	0.691	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase
8	9606.ENSP00000220849	0.642	Eukaryotic translation initiation factor 3 subunit E
9	9606.ENSP00000485663	0.610	Eukaryotic translation initiation factor 3 subunit L
10	9606.ENSP00000270570	0.537	Multidrug and toxin extrusion protein 1
11	9606.ENSP00000326671	0.537	Multidrug and toxin extrusion protein 2
12	9606.ENSP00000374213	0.533	E1A-binding protein p400
13	9606.ENSP00000362330	0.525	Chromodomain-helicase-DNA-binding protein 6
14	9606.ENSP00000387010	0.524	R3H domain containing 1
15	9606.ENSP00000275732	0.514	GRB10-interacting GYF protein 1
16	9606.ENSP00000403925	0.509	Tubulin-specific chaperone cofactor E-like protein
17	9606.ENSP00000456337	0.509	Uncharacterized protein C15orf65
18	9606.ENSP00000374211	0.506	EP400 N-terminal-like protein
19	9606.ENSP00000464893	0.505	RING finger protein unkempt homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.887	multicellular organismal process
GO:0032502	0.859	developmental process
GO:0048856	0.847	anatomical structure development
GO:0009987	0.846	cellular process
GO:0007275	0.731	multicellular organism development
GO:0065007	0.602	biological regulation
GO:0009792	0.578	embryo development ending in birth or egg hatching
GO:0050789	0.538	regulation of biological process
GO:0050794	0.386	regulation of cellular process
GO:0008152	0.346	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0016020	0.998	membrane
GO:0043227	0.869	membrane-bounded organelle
GO:0043229	0.865	intracellular organelle
GO:0043231	0.837	intracellular membrane-bounded organelle
GO:0070013	0.400	intracellular organelle lumen
GO:0005886	0.358	plasma membrane
GO:0031981	0.355	nuclear lumen
GO:0005654	0.344	nucleoplasm
GO:0032991	0.313	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]