StarFunc result for job id Q5JTC6

User Input

>input (1135 residues)
METQKDEAAQAKGAAASGSTREQTAEKGAKNKAAEATEGPTSEPSSSGPGRLKKTAMKLF
GGKKGICTLPSFFGGGRSKGSGKGSSKKGLSKSKTHDGLSEAAHGPEDVVSEGTGFSLPL
PELPCQFPSSQSAHGALETGSRCKTSVAGATEKAVAEKFPSMPKPKKGLKGFFSSIRRHR
KSKVTGAEQSEPGAKGPERVRARPHEHVSSAPQVPCFEETFQAPRKENANPQDAPGPKVS
PTPEPSPPATEKMACKDPEKPMEACASAHVQPKPAPEASSLEEPHSPETGEKVVAGEVNP
PNGPVGDPLSLLFGDVTSLKSFDSLTGCGDIIAEQDMDSMTDSMASGGQRANRDGTKRSS
CLVTYQGGGEEMALPDDDDEEEEEEEEVELEEEEEEVKEEEEDDDLEYLWETAQMYPRPN
MNLGYHPTTSPGHHGYMLLDPVRSYPGLAPGELLTPQSDQQESAPNSDEGYYDSTTPGFE
DDSGEALGLVRRDCLPRDSYSGDALYEFYEPDDSLENSPPGDDCLYDLHGRSSEMFDPFL
NFEPFLSSRPPGAMETEEERLVTIQKQLLYWELRREQLEAQEARAREAHAREAHAREAYT
REAYGREAYAREAHTWEAHGREARTREAQAREVRCRETQVRETQARQEKPVLEYQMRPLG
PSVMGLAAGVSGTSQISHRGITSAFPTTASSEPDWRDFRPLEKRYEGTCSKKDQSTCLMQ
LFQSDAMFEPDMQEANFGGSPRRAYPTYSPPEDPEEEEVEKEGNATVSFSQALVEFTSNG
NLFSSMSCSSDSDSSFTQNLPELPPMVTFDIADVERDGEGKCEENPEFHNDEDLAASLEA
FELGYYHKHAFNNYHSRFYQGLPWGVSSLPRYLGLPGLHPRPPPAAMALNRRSRSLDTAE
TLEMELSNSHLVQGYLESDELQAQQEDSDEEDEEEEEGEWSRDSPLSLYTEPPGAYDWPA
WAPCPLPVGPGPAWISPNQLDRPSSQSPYRQATCCIPPMTMSISLSVPESRAPGESGPQL
ARPSHLHLPMGPCYNLQPQASQSMRARPRDVLLPVDEPSCSSSSGGFSPSPLPQAKPVGI
THGIPQLPRVRPEHPQPQPTHYGPSSLDLSKERAEQGASLATSYSSTAMNGNLAK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5JTC6	1.000	1.000	0.000	1135	1.000	1.000	Q5JTC6.pdb.gz	AMER1_HUMAN APC membrane recruitment protein 1 OS=Homo sapiens OX=9606 GN=AMER1 PE=1 SV=2
2	AFDB:F1RDM5	0.053	0.060	5.493E-18	930	0.267	0.326	F1RDM5.pdb.gz	AMER1_DANRE APC membrane recruitment protein 1 OS=Danio rerio OX=7955 GN=amer1 PE=2 SV=1
3	AFDB:Q9BX66	0.044	0.039	2.542E-2	1292	0.159	0.140	Q9BX66.pdb.gz	SRBS1_HUMAN Sorbin and SH3 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SORBS1 PE=1 SV=3
4	AFDB:Q9HCM7	0.038	0.041	2.719E-2	1045	0.167	0.181	Q9HCM7.pdb.gz	FBSL_HUMAN Fibrosin-1-like protein OS=Homo sapiens OX=9606 GN=FBRSL1 PE=1 SV=4
5	AFDB:Q57U60	0.038	0.038	4.648E-2	1172	0.124	0.120	Q57U60.pdb.gz	Q57U60_TRYB2 T. brucei spp.-specific protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.6H23.100 PE=4 SV=1
6	AFDB:Q9XER9	0.036	0.032	1.271E-1	1392	0.158	0.129	Q9XER9.pdb.gz	HUA2_ARATH ENHANCER OF AG-4 protein 2 OS=Arabidopsis thaliana OX=3702 GN=HUA2 PE=2 SV=1
7	AFDB:Q380Z7	0.037	0.024	1.359E-1	2059	0.144	0.079	Q380Z7.pdb.gz	Q380Z7_TRYB2 Flagellar Member 7 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.8650 PE=4 SV=1
8	AFDB:B0S8G4	0.040	0.031	1.662E-1	1645	0.146	0.101	B0S8G4.pdb.gz
9	AFDB:A0A2R8RZV0	0.039	0.041	2.032E-1	1059	0.132	0.142	A0A2R8RZV0.pdb.gz
10	AFDB:O81283	0.037	0.030	2.173E-1	1503	0.107	0.081	O81283.pdb.gz	TC159_ARATH Translocase of chloroplast 159, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TOC159 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5JTC6	0.0	2318	1135	1.000	1.000	AMER1_HUMAN APC membrane recruitment protein 1 OS=Homo sapiens OX=9606 GN=AMER1 PE=1 SV=2
2	Q7TS75	0.0	1614	1132	0.795	0.797	AMER1_MOUSE APC membrane recruitment protein 1 OS=Mus musculus OX=10090 GN=Amer1 PE=2 SV=3
3	F1RDM5	7.12e-66	243	930	0.187	0.228	AMER1_DANRE APC membrane recruitment protein 1 OS=Danio rerio OX=7955 GN=amer1 PE=2 SV=1
4	Q8N7J2	2.18e-42	168	671	0.170	0.288	AMER2_HUMAN APC membrane recruitment protein 2 OS=Homo sapiens OX=9606 GN=AMER2 PE=1 SV=3
5	Q6INC4	2.56e-33	139	624	0.143	0.260	AMER2_XENLA APC membrane recruitment protein 2 OS=Xenopus laevis OX=8355 GN=amer2 PE=2 SV=2
6	Q8N944	1.33e-10	68.2	861	0.065	0.086	AMER3_HUMAN APC membrane recruitment protein 3 OS=Homo sapiens OX=9606 GN=AMER3 PE=1 SV=2
7	E7EWR4	0.002	44.7	597	0.042	0.080	E7EWR4_HUMAN Cleavage stimulation factor subunit 2 OS=Homo sapiens OX=9606 GN=CSTF2 PE=1 SV=1
8	P33240	0.002	44.7	577	0.041	0.080	CSTF2_HUMAN Cleavage stimulation factor subunit 2 OS=Homo sapiens OX=9606 GN=CSTF2 PE=1 SV=1
9	Q0E8J3	0.021	41.6	3640	0.033	0.010	Q0E8J3_DROME Zormin, isoform I OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=2
10	M9PBJ1	0.024	41.6	3664	0.033	0.010	M9PBJ1_DROME Zormin, isoform J OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=1
11	M9PE03	0.025	41.6	3536	0.033	0.010	M9PE03_DROME Zormin, isoform E OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=1
12	Q0E8J4	0.035	40.8	3079	0.033	0.012	Q0E8J4_DROME Zormin, isoform G OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=2
13	Q7Z1Y4	0.035	40.8	2935	0.033	0.013	Q7Z1Y4_DROME Zormin OS=Drosophila melanogaster OX=7227 GN=zormin PE=4 SV=1
14	Q9W053	0.036	40.8	2935	0.033	0.013	Q9W053_DROME Zormin, isoform F OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=4
15	Q0E8J5	0.042	40.8	2960	0.033	0.013	Q0E8J5_DROME Zormin, isoform K OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=2
16	A0A8I5ZY65	1.3	35.4	549	0.019	0.040	A0A8I5ZY65_RAT Cleavage stimulation factor, 3' pre-RNA subunit 2 OS=Rattus norvegicus OX=10116 GN=Cstf2 PE=1 SV=1
17	B4F7F1	1.3	35.4	575	0.017	0.033	B4F7F1_RAT Cstf2 protein OS=Rattus norvegicus OX=10116 GN=Cstf2 PE=1 SV=1
18	A0A0G2JWP1	1.4	35.4	569	0.017	0.033	A0A0G2JWP1_RAT Cleavage stimulation factor, 3' pre-RNA subunit 2 OS=Rattus norvegicus OX=10116 GN=Cstf2 PE=1 SV=2
19	A0A8J8XR33	1.4	35.4	624	0.017	0.030	A0A8J8XR33_RAT Cleavage stimulation factor, 3' pre-RNA subunit 2 OS=Rattus norvegicus OX=10116 GN=Cstf2 PE=1 SV=1
20	A0A0G2K6F9	1.6	35.0	478	0.019	0.046	A0A0G2K6F9_RAT Cleavage stimulation factor, 3' pre-RNA subunit 2 OS=Rattus norvegicus OX=10116 GN=Cstf2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09422 WTX	4.4e-136	466.4	WTX protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000329117

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262320	0.999	Axin-1
2	9606.ENSP00000257430	0.995	Adenomatous polyposis coli protein
3	9606.ENSP00000344456	0.994	Catenin beta-1
4	9606.ENSP00000359206	0.949	F-box/WD repeat-containing protein 1A
5	9606.ENSP00000294304	0.942	Low-density lipoprotein receptor-related protein 5
6	9606.ENSP00000324806	0.940	Glycogen synthase kinase-3 beta
7	9606.ENSP00000261349	0.936	Low-density lipoprotein receptor-related protein 6
8	9606.ENSP00000284523	0.931	Protein Wnt-3a
9	9606.ENSP00000171111	0.930	Kelch-like ECH-associated protein 1
10	9606.ENSP00000368169	0.929	Segment polarity protein dishevelled homolog DVL-1
11	9606.ENSP00000005340	0.918	Segment polarity protein dishevelled homolog DVL-2
12	9606.ENSP00000316054	0.908	Segment polarity protein dishevelled homolog DVL-3
13	9606.ENSP00000293549	0.905	Proto-oncogene Wnt-1
14	9606.ENSP00000323901	0.903	Frizzled-2
15	9606.ENSP00000340677	0.903	Protein Wnt-8b
16	9606.ENSP00000360060	0.903	Proto-oncogene FRAT1
17	9606.ENSP00000287934	0.902	Frizzled-1
18	9606.ENSP00000360058	0.902	GSK-3-binding protein FRAT2
19	9606.ENSP00000426653	0.902	Protein Wnt-8a
20	9606.ENSP00000421689	0.874	Casein kinase I isoform alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1904713	1.000	beta-catenin destruction complex binding
GO:0008013	1.000	beta-catenin binding
GO:0005546	1.000	phosphatidylinositol-4,5-bisphosphate binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0060255	0.972	regulation of macromolecule metabolic process
GO:0080090	0.950	regulation of primary metabolic process
GO:0051173	0.945	positive regulation of nitrogen compound metabolic process
GO:0010604	0.945	positive regulation of macromolecule metabolic process
GO:0048522	0.944	positive regulation of cellular process
GO:0010646	0.932	regulation of cell communication
GO:0023051	0.931	regulation of signaling
GO:0048523	0.907	negative regulation of cellular process
GO:0030111	0.906	regulation of Wnt signaling pathway
GO:0051246	0.891	regulation of protein metabolic process
GO:0009987	0.885	cellular process
GO:0051247	0.822	positive regulation of protein metabolic process
GO:0031399	0.808	regulation of protein modification process
GO:0030178	0.763	negative regulation of Wnt signaling pathway
GO:0031323	0.620	regulation of cellular metabolic process
GO:0032502	0.585	developmental process
GO:0048856	0.581	anatomical structure development
GO:0031401	0.479	positive regulation of protein modification process
GO:0009967	0.426	positive regulation of signal transduction
GO:0032501	0.402	multicellular organismal process
GO:0007275	0.384	multicellular organism development
GO:0009894	0.374	regulation of catabolic process
GO:0060828	0.361	regulation of canonical Wnt signaling pathway
GO:0042176	0.354	regulation of protein catabolic process
GO:0050896	0.350	response to stimulus
GO:0009896	0.335	positive regulation of catabolic process
GO:0045732	0.332	positive regulation of protein catabolic process
GO:1903320	0.329	regulation of protein modification by small protein conjugation or removal
GO:0071704	0.318	organic substance metabolic process
GO:0009892	0.316	negative regulation of metabolic process
GO:0090090	0.311	negative regulation of canonical Wnt signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0005886	0.999	plasma membrane
GO:0016604	0.989	nuclear body
GO:0032991	0.488	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]