StarFunc result for job id Q5JTH9

User Input

>input (1297 residues)
MGRSGKLPSGVSAKLKRWKKGHSSDSNPAICRHRQAARSRFFSRPSGRSDLTVDAVKLHN
ELQSGSLRLGKSEAPETPMEEEAELVLTEKSSGTFLSGLSDCTNVTFSKVQRFWESNSAA
HKEICAVLAAVTEVIRSQGGKETETEYFAALMTTMEAVESPESLAAVAYLLNLVLKRVPS
PVLIKKFSDTSKAFMDIMSAQASSGSTSVLRWVLSCLATLLRKQDLEAWGYPVTLQVYHG
LLSFTVHPKPKIRKAAQHGVCSVLKGSEFMFEKAPAHHPAAISTAKFCIQEIEKSGGSKE
ATTTLHMLTLLKDLLPCFPEGLVKSCSETLLRVMTLSHVLVTACAMQAFHSLFHARPGLS
TLSAELNAQIITALYDYVPSENDLQPLLAWLKVMEKAHINLVRLQWDLGLGHLPRFFGTA
VTCLLSPHSQVLTAATQSLKEILKECVAPHMADIGSVTSSASGPAQSVAKMFRAVEEGLT
YKFHAAWSSVLQLLCVFFEACGRQAHPVMRKCLQSLCDLRLSPHFPHTAALDQAVGAAVT
SMGPEVVLQAVPLEIDGSEETLDFPRSWLLPVIRDHVQETRLGFFTTYFLPLANTLKSKA
MDLAQAGSTVESKIYDTLQWQMWTLLPGFCTRPTDVAISFKGLARTLGMAISERPDLRVT
VCQALRTLITKGCQAEADRAEVSRFAKNFLPILFNLYGQPVAAGDTPAPRRAVLETIRTY
LTITDTQLVNSLLEKASEKVLDPASSDFTRLSVLDLVVALAPCADEAAISKLYSTIRPYL
ESKAHGVQKKAYRVLEEVCASPQGPGALFVQSHLEDLKKTLLDSLRSTSSPAKRPRLKCL
LHIVRKLSAEHKEFITALIPEVILCTKEVSVGARKNAFALLVEMGHAFLRFGSNQEEALQ
CYLVLIYPGLVGAVTMVSCSILALTHLLFEFKGLMGTSTVEQLLENVCLLLASRTRDVVK
SALGFIKVAVTVMDVAHLAKHVQLVMEAIGKLSDDMRRHFRMKLRNLFTKFIRKFGFELV
KRLLPEEYHRVLVNIRKAEARAKRHRALSQAAVEEEEEEEEEEEPAQGKGDSIEEILADS
EDEEDNEEEERSRGKEQRKLARQRSRAWLKEGGGDEPLNFLDPKVAQRVLATQPGPGRGR
KKDHGFKVSADGRLIIREEADGNKMEEEEGAKGEDEEMADPMEDVIIRNKKHQKLKHQKE
AEEEELEIPPQYQAGGSGIHRPVAKKAMPGAEYKAKKAKGDVKKKGRPDPYAYIPLNRSK
LNRRKKMKLQGQFKGLVKAARRGSQVGHKNRRKDRRP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5JTH9	1.000	1.000	0.000	1297	1.000	1.000	Q5JTH9.pdb.gz	RRP12_HUMAN RRP12-like protein OS=Homo sapiens OX=9606 GN=RRP12 PE=1 SV=2
2	PDB:7wttK	0.637	0.797	3.076E-86	1022	0.786	0.997	7wttK.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
3	AFDB:F4IHU8	0.578	0.585	1.374E-36	1280	0.237	0.241	F4IHU8.pdb.gz	F4IHU8_ARATH ARM repeat superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At2g34357 PE=1 SV=1
4	AFDB:Q9Y824	0.494	0.612	1.911E-20	1001	0.129	0.167	Q9Y824.pdb.gz	YON1_SCHPO Uncharacterized protein C1105.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1105.01 PE=1 SV=2
5	PDB:6xu2A	0.229	0.263	2.016E-10	1091	0.086	0.103	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
6	AFDB:Q5B163	0.226	0.261	6.128E-10	1095	0.087	0.103	Q5B163.pdb.gz	Q5B163_EMENI Importin beta-3 subunit, putative (AFU_orthologue AFUA_1G06790) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05717 PE=3 SV=1
7	PDB:3w3uA	0.254	0.302	1.513E-9	1030	0.090	0.114	3w3uA.pdb.gz
8	PDB:4jlqA	0.222	0.308	2.155E-9	840	0.090	0.139	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
9	PDB:2xwuB	0.257	0.334	3.295E-9	910	0.091	0.130	2xwuB.pdb.gz
10	PDB:6ahd1	0.246	0.285	4.221E-9	1048	0.088	0.109	6ahd1.pdb.gz	Structures of the human pre-catalytic spliceosome and its precursor spliceosome.
11	PDB:6tc0C	0.303	0.371	4.221E-9	994	0.120	0.157	6tc0C.pdb.gz
12	PDB:3nd2A	0.233	0.324	5.601E-9	861	0.095	0.143	3nd2A.pdb.gz
13	PDB:4a0cA	0.230	0.251	9.863E-9	1155	0.105	0.118	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
14	PDB:6x9oA	0.204	0.123	1.508E-8	2425	0.110	0.059	6x9oA.pdb.gz
15	AFDB:G5EC05	0.164	0.144	8.976E-8	1570	0.121	0.100	G5EC05.pdb.gz	G5EC05_CAEEL Cnd1 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=evl-14 PE=1 SV=1
16	AFDB:Q6PR54	0.228	0.135	9.265E-7	2419	0.123	0.066	Q6PR54.pdb.gz	RIF1_MOUSE Telomere-associated protein RIF1 OS=Mus musculus OX=10090 GN=Rif1 PE=1 SV=2
17	AFDB:E7FB07	0.143	0.170	8.301E-6	1047	0.078	0.096	E7FB07.pdb.gz	E7FB07_DANRE Armadillo repeat containing 4 OS=Danio rerio OX=7955 GN=armc4 PE=1 SV=1
18	AFDB:Q10669	0.138	0.120	1.411E-5	1587	0.115	0.094	Q10669.pdb.gz	MED23_CAEEL Mediator of RNA polymerase II transcription subunit 23 OS=Caenorhabditis elegans OX=6239 GN=sur-2 PE=1 SV=1
19	AFDB:P54362	0.183	0.216	1.625E-5	1034	0.096	0.120	P54362.pdb.gz	AP3D_DROME AP-3 complex subunit delta OS=Drosophila melanogaster OX=7227 GN=g PE=1 SV=4
20	AFDB:Q54NU8	0.147	0.139	1.684E-5	1408	0.096	0.089	Q54NU8.pdb.gz	TSTA_DICDI TSET complex member tstA OS=Dictyostelium discoideum OX=44689 GN=tstA PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5JTH9	0.0	2665	1297	1.000	1.000	RRP12_HUMAN RRP12-like protein OS=Homo sapiens OX=9606 GN=RRP12 PE=1 SV=2
2	Q12754	1.65e-94	333	1228	0.229	0.242	RRP12_YEAST Ribosomal RNA-processing protein 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RRP12 PE=1 SV=1
3	F4IHU8	5.05e-92	327	1280	0.241	0.244	F4IHU8_ARATH ARM repeat superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At2g34357 PE=1 SV=1
4	Q9C0X8	7.06e-76	277	1163	0.212	0.236	RRP12_SCHPO Putative ribosomal RNA-processing protein 12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rrp12 PE=3 SV=1
5	Q9Y824	8.09e-10	65.9	1001	0.082	0.106	YON1_SCHPO Uncharacterized protein C1105.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1105.01 PE=1 SV=2
6	Q386Q9	0.041	40.8	1292	0.019	0.019	Q386Q9_TRYB2 Ribosomal RNA-processing protein 12-like conserved domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.0110 PE=4 SV=1
7	Q9WTK3	1.2	35.8	621	0.021	0.043	GPAA1_MOUSE Glycosylphosphatidylinositol anchor attachment 1 protein OS=Mus musculus OX=10090 GN=Gpaa1 PE=1 SV=3
8	Q03609	3.2	34.7	983	0.025	0.034	CLAP3_CAEEL Protein CLASP-3 OS=Caenorhabditis elegans OX=6239 GN=cls-3 PE=3 SV=3
9	C8V3B2	3.3	34.7	2385	0.022	0.012	C8V3B2_EMENI non-specific serine/threonine protein kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05982 PE=3 SV=1
10	Q9Y6K1	6.5	33.5	912	0.012	0.016	DNM3A_HUMAN DNA (cytosine-5)-methyltransferase 3A OS=Homo sapiens OX=9606 GN=DNMT3A PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19496 DUF6031	2e+02	13.1	Family of unknown function (DUF6031)
2	PF08161 NUC173	1.1e-71	252.3	NUC173 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000446184

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000301364	0.997	Pre-rRNA-processing protein TSR1 homolog
2	9606.ENSP00000230340	0.995	Bystin
3	9606.ENSP00000483495	0.991	Probable ATP-dependent RNA helicase DDX27
4	9606.ENSP00000223073	0.987	RNA-binding protein 28
5	9606.ENSP00000264279	0.984	Nucleolar protein 58
6	9606.ENSP00000360412	0.981	Nucleolar complex protein 3 homolog
7	9606.ENSP00000363642	0.980	Ribosome biogenesis protein BMS1 homolog
8	9606.ENSP00000405068	0.980	Nucleolar protein 14
9	9606.ENSP00000285814	0.978	Nucleolar protein interacting with the FHA domain of MKI67
10	9606.ENSP00000356548	0.978	Protein LTV1 homolog
11	9606.ENSP00000358812	0.977	Protein RRP5 homolog
12	9606.ENSP00000419004	0.977	60S ribosomal export protein NMD3
13	9606.ENSP00000257829	0.969	RNA cytidine acetyltransferase
14	9606.ENSP00000460871	0.967	Ribosomal L1 domain-containing protein 1
15	9606.ENSP00000328854	0.966	Nucleolar complex protein 4 homolog
16	9606.ENSP00000354040	0.966	Nucleolar GTP-binding protein 1
17	9606.ENSP00000370589	0.966	Nucleolar protein 56
18	9606.ENSP00000396673	0.966	pre-rRNA processing protein FTSJ3
19	9606.ENSP00000263657	0.964	RNA-binding protein PNO1
20	9606.ENSP00000346725	0.964	Pescadillo homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0005515	0.896	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0071704	0.980	organic substance metabolic process
GO:0044237	0.979	cellular metabolic process
GO:0006807	0.974	nitrogen compound metabolic process
GO:0043170	0.968	macromolecule metabolic process
GO:0044238	0.960	primary metabolic process
GO:0034641	0.948	cellular nitrogen compound metabolic process
GO:0006139	0.885	nucleobase-containing compound metabolic process
GO:0090304	0.880	nucleic acid metabolic process
GO:0010467	0.868	gene expression
GO:0071840	0.858	cellular component organization or biogenesis
GO:0065007	0.855	biological regulation
GO:0044085	0.854	cellular component biogenesis
GO:0016070	0.850	RNA metabolic process
GO:0050789	0.814	regulation of biological process
GO:0006396	0.782	RNA processing
GO:0022613	0.775	ribonucleoprotein complex biogenesis
GO:0050794	0.754	regulation of cellular process
GO:0034660	0.749	ncRNA metabolic process
GO:0042254	0.531	ribosome biogenesis
GO:0034470	0.489	ncRNA processing
GO:0019222	0.457	regulation of metabolic process
GO:0016072	0.429	rRNA metabolic process
GO:0006364	0.384	rRNA processing
GO:0080090	0.367	regulation of primary metabolic process
GO:0048518	0.360	positive regulation of biological process
GO:0051171	0.356	regulation of nitrogen compound metabolic process
GO:0031323	0.356	regulation of cellular metabolic process
GO:0060255	0.328	regulation of macromolecule metabolic process
GO:0042274	0.328	ribosomal small subunit biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005730	1.000	nucleolus
GO:0005829	0.999	cytosol
GO:0005886	0.996	plasma membrane
GO:0005654	0.984	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]