StarFunc result for job id Q5JTZ9

User Input

>input (985 residues)
MAASVAAAARRLRRAIRRSPAWRGLSHRPLSSEPPAAKASAVRAAFLNFFRDRHGHRLVP
SASVRPRGDPSLLFVNAGMNQFKPIFLGTVDPRSEMAGFRRVANSQKCVRAGGHHNDLED
VGRDLSHHTFFEMLGNWAFGGEYFKEEACNMAWELLTQVYGIPEERLWISYFDGDPKAGL
DPDLETRDIWLSLGVPASRVLSFGPQENFWEMGDTGPCGPCTEIHYDLAGGVGAPQLVEL
WNLVFMQHNREADGSLQPLPQRHVDTGMGLERLVAVLQGKHSTYDTDLFSPLLNAIQQGC
RAPPYLGRVGVADEGRTDTAYRVVADHIRTLSVCISDGIFPGMSGPPLVLRRILRRAVRF
SMEILKAPPGFLGSLVPVVVETLGDAYPELQRNSAQIANLVSEDEAAFLASLERGRRIID
RTLRTLGPSDMFPAEVAWSLSLCGDLGLPLDMVELMLEEKGVQLDSAGLERLAQEEAQHR
ARQAEPVQKQGLWLDVHALGELQRQGVPPTDDSPKYNYSLRPSGSYEFGTCEAQVLQLYT
EDGTAVASVGKGQRCGLLLDRTNFYAEQGGQASDRGYLVRAGQEDVLFPVARAQVCGGFI
LHEAVAPECLRLGDQVQLHVDEAWRLGCMAKHTATHLLNWALRQTLGPGTEQQGSHLNPE
QLRLDVTTQTPLTPEQLRAVENTVQEAVGQDEAVYMEEVPLALTAQVPGLRSLDEVYPDP
VRVVSVGVPVAHALDPASQAALQTSVELCCGTHLLRTGAVGDLVIIGDRQLSKGTTRLLA
VTGEQAQQARELGQSLAQEVKAATERLSLGSRDVAEALRLSKDIGRLIEAVETAVMPQWQ
RRELLATVKMLQRRANTAIRKLQMGQAAKKTQELLERHSKGPLIVDTVSAESLSVLVKVV
RQLCEQAPSTSVLLLSPQPMGKVLCACQVAQGAMPTFTAEAWALAVCSHMGGKAWGSRVV
AQGTGSTTDLEAALSIAQTYALSQL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14CH7	0.945	0.950	0.000	980	0.830	0.835	Q14CH7.pdb.gz	SYAM_MOUSE Alanine--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Aars2 PE=1 SV=1
2	AFDB:Q5JTZ9	1.000	1.000	0.000	985	1.000	1.000	Q5JTZ9.pdb.gz	SYAM_HUMAN Alanine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=AARS2 PE=1 SV=1
3	AFDB:Q9VLM8	0.838	0.853	0.000	966	0.420	0.429	Q9VLM8.pdb.gz	SYAC_DROME Alanine--tRNA ligase, cytoplasmic OS=Drosophila melanogaster OX=7227 GN=AlaRS PE=2 SV=1
4	AFDB:P49588	0.472	0.480	7.915E-104	968	0.446	0.454	P49588.pdb.gz	SYAC_HUMAN Alanine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=AARS1 PE=1 SV=2
5	AFDB:H3BPK7	0.856	0.845	3.461E-103	999	0.445	0.438	H3BPK7.pdb.gz	H3BPK7_HUMAN Alanine--tRNA ligase OS=Homo sapiens OX=9606 GN=AARS1 PE=1 SV=4
6	AFDB:O13914	0.833	0.855	2.399E-94	959	0.388	0.398	O13914.pdb.gz	SYA_SCHPO Alanine--tRNA ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ala1 PE=1 SV=1
7	AFDB:P36428	0.829	0.815	5.947E-94	1003	0.399	0.392	P36428.pdb.gz	SYA_ARATH Alanine--tRNA ligase OS=Arabidopsis thaliana OX=3702 GN=ALATS PE=1 SV=3
8	AFDB:P40825	0.441	0.442	3.264E-91	983	0.379	0.379	P40825.pdb.gz	SYA_YEAST Alanine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALA1 PE=1 SV=3
9	AFDB:Q5A8K2	0.446	0.453	4.520E-90	969	0.390	0.396	Q5A8K2.pdb.gz	SYA_CANAL Alanine--tRNA ligase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ALA1 PE=1 SV=1
10	AFDB:Q583T3	0.767	0.781	7.098E-87	966	0.357	0.364	Q583T3.pdb.gz	Q583T3_TRYB2 Alanine--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.3D8.610 PE=3 SV=1
11	PDB:3wqyA	0.585	0.630	1.132E-37	905	0.210	0.229	3wqyA.pdb.gz	The selective tRNA aminoacylation mechanism based on a single G.U pair
12	PDB:2e1bA	0.186	0.802	9.348E-11	216	0.053	0.241	2e1bA.pdb.gz
13	PDB:3rfnA	0.132	0.780	1.146E-6	151	0.034	0.219	3rfnA.pdb.gz	Computational design of high-affinity epitope scaffolds by backbone grafting of a linear epitope.
14	PDB:1v4pC	0.129	0.747	2.346E-6	155	0.032	0.206	1v4pC.pdb.gz	Crystal structure of alanyl-tRNA synthetase editing-domain homolog (PH0574) from a hyperthermophile, Pyrococcus horikoshii OT3 at 1.45 A resolution
15	PDB:7eivB	0.160	0.465	8.525E-6	300	0.059	0.193	7eivB.pdb.gz	X-shaped structure of bacterial heterotetrameric tRNA synthetase suggests cryptic prokaryote functions and a rationale for synthetase classifications.
16	PDB:6chdA	0.141	0.254	1.363E-4	506	0.043	0.083	6chdA.pdb.gz	Crystal Structure of Human Lysyl-tRNA Synthetase complexed with L-Lysylsulfamoyl Adenosine
17	PDB:1qf6A	0.165	0.241	1.429E-4	641	0.036	0.055	1qf6A.pdb.gz	The structure of threonyl-tRNA synthetase-tRNA(Thr) complex enlightens its repressor activity and reveals an essential zinc ion in the active site
18	PDB:5x6cA	0.111	0.194	1.904E-4	539	0.034	0.061	5x6cA.pdb.gz	Structural basis for tRNA-dependent cysteine biosynthesis
19	PDB:7k98A	0.157	0.403	2.927E-4	343	0.041	0.117	7k98A.pdb.gz	Mycobacterium tuberculosis Phe-tRNA synthetase: structural insights into tRNA recognition and aminoacylation.
20	PDB:3pcoC	0.134	0.355	6.287E-4	323	0.039	0.118	3pcoC.pdb.gz	Idiosyncrasy and identity in the prokaryotic phe-system: crystal structure of E. coli phenylalanyl-tRNA synthetase complexed with phenylalanine and AMP.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H3BPK7	0.0	821	999	0.454	0.447	H3BPK7_HUMAN Alanine--tRNA ligase OS=Homo sapiens OX=9606 GN=AARS1 PE=1 SV=4
2	O13914	0.0	713	959	0.400	0.411	SYA_SCHPO Alanine--tRNA ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ala1 PE=1 SV=1
3	P36428	0.0	682	1003	0.388	0.381	SYA_ARATH Alanine--tRNA ligase OS=Arabidopsis thaliana OX=3702 GN=ALATS PE=1 SV=3
4	P40825	0.0	707	983	0.383	0.384	SYA_YEAST Alanine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALA1 PE=1 SV=3
5	P49588	0.0	837	968	0.452	0.460	SYAC_HUMAN Alanine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=AARS1 PE=1 SV=2
6	P50475	0.0	836	968	0.452	0.460	SYAC_RAT Alanine--tRNA ligase, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Aars1 PE=1 SV=3
7	Q14CH7	0.0	1646	980	0.824	0.829	SYAM_MOUSE Alanine--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Aars2 PE=1 SV=1
8	Q583T3	0.0	580	966	0.341	0.348	Q583T3_TRYB2 Alanine--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.3D8.610 PE=3 SV=1
9	Q5A8K2	0.0	719	969	0.393	0.399	SYA_CANAL Alanine--tRNA ligase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ALA1 PE=1 SV=1
10	Q5JTZ9	0.0	2006	985	1.000	1.000	SYAM_HUMAN Alanine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=AARS2 PE=1 SV=1
11	Q8BGQ7	0.0	837	968	0.452	0.460	SYAC_MOUSE Alanine--tRNA ligase, cytoplasmic OS=Mus musculus OX=10090 GN=Aars1 PE=1 SV=1
12	Q9VLM8	0.0	810	966	0.427	0.436	SYAC_DROME Alanine--tRNA ligase, cytoplasmic OS=Drosophila melanogaster OX=7227 GN=AlaRS PE=2 SV=1
13	A7ZQC5	9.25e-162	499	876	0.344	0.387	SYA_ECO24 Alanine--tRNA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) OX=331111 GN=alaS PE=3 SV=1
14	P00957	1.93e-161	499	876	0.344	0.387	SYA_ECOLI Alanine--tRNA ligase OS=Escherichia coli (strain K12) OX=83333 GN=alaS PE=1 SV=2
15	Q8ID31	6.22e-154	493	1408	0.321	0.224	Q8ID31_PLAF7 Alanine--tRNA ligase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1367700 PE=3 SV=1
16	Q9VRJ1	4.28e-148	468	1012	0.355	0.346	SYAM_DROME Alanine--tRNA ligase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=AlaRS-m PE=2 SV=1
17	Q9FFC7	1.96e-114	377	978	0.264	0.266	SYAP_ARATH Alanine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=EMB86 PE=1 SV=2
18	P9WFW7	4.67e-111	366	904	0.283	0.309	SYA_MYCTU Alanine--tRNA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=alaS PE=1 SV=1
19	Q57984	7.18e-47	184	892	0.206	0.228	SYA_METJA Alanine--tRNA ligase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=alaS PE=1 SV=1
20	O58035	1.18e-42	171	915	0.209	0.225	SYA_PYRHO Alanine--tRNA ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) OX=70601 GN=alaS PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18395 Cas3_C	1.2e+02	14.6	Cas3 C-terminal domain
2	PF02272 DHHA1	1.5	20.7	DHHA1 domain
3	PF01411 tRNA-synt_2c	4.9e-171	581.6	tRNA synthetases class II (A)
4	PF07973 tRNA_SAD	2.1e-05	35.8	Threonyl and Alanyl tRNA synthetase second additional domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000244571

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355890	0.977	Bifunctional glutamate/proline--tRNA ligase
2	9606.ENSP00000362576	0.933	Tyrosine--tRNA ligase, cytoplasmic
3	9606.ENSP00000264161	0.928	Aspartate--tRNA ligase, cytoplasmic
4	9606.ENSP00000355889	0.920	Isoleucine--tRNA ligase, mitochondrial
5	9606.ENSP00000373918	0.906	Glycine--tRNA ligase
6	9606.ENSP00000408576	0.900	Probable leucine--tRNA ligase, mitochondrial
7	9606.ENSP00000262027	0.896	Methionine--tRNA ligase, cytoplasmic
8	9606.ENSP00000256854	0.886	Asparagine--tRNA ligase, cytoplasmic
9	9606.ENSP00000355086	0.877	Aspartate--tRNA ligase, mitochondrial
10	9606.ENSP00000425634	0.877	Histidine--tRNA ligase, cytoplasmic
11	9606.ENSP00000364794	0.876	Isoleucine--tRNA ligase, cytoplasmic
12	9606.ENSP00000320658	0.862	Tyrosine--tRNA ligase, mitochondrial
13	9606.ENSP00000364815	0.859	Valine--tRNA ligase
14	9606.ENSP00000377954	0.856	Leucine--tRNA ligase, cytoplasmic
15	9606.ENSP00000234677	0.854	Serine--tRNA ligase, cytoplasmic
16	9606.ENSP00000316335	0.849	Phenylalanine--tRNA ligase, mitochondrial
17	9606.ENSP00000338093	0.845	Probable threonine--tRNA ligase 2, cytoplasmic
18	9606.ENSP00000325448	0.844	Lysine--tRNA ligase
19	9606.ENSP00000230771	0.840	Probable histidine--tRNA ligase, mitochondrial
20	9606.ENSP00000358060	0.834	Threonine--tRNA ligase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004813	1.000	alanine-tRNA ligase activity
GO:0016787	0.656	hydrolase activity
GO:0016788	0.399	hydrolase activity, acting on ester bonds
GO:0002161	0.392	aminoacyl-tRNA editing activity
GO:0003676	0.376	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:0044237	0.998	cellular metabolic process
GO:0043170	0.996	macromolecule metabolic process
GO:1901564	0.995	organonitrogen compound metabolic process
GO:0006412	0.990	translation
GO:0043039	0.988	tRNA aminoacylation
GO:0006418	0.982	tRNA aminoacylation for protein translation
GO:0032543	0.803	mitochondrial translation
GO:0000959	0.779	mitochondrial RNA metabolic process
GO:0006419	0.413	alanyl-tRNA aminoacylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.998	mitochondrion
GO:0070013	0.791	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:12540	1.000	ATP + L-alanine + tRNA(Ala) = AMP + diphosphate + L-alanyl-tRNA(Ala)
EC:6.1.1.7	1.000	alanine--tRNA ligase.
EC:3.-.-.-	0.656	Hydrolases.
EC:3.1.-.-	0.399	Acting on ester bonds.
EC:3.1.1.-	0.392	Carboxylic ester hydrolases.

[back to server]