StarFunc result for job id Q5JU85

User Input

>input (1488 residues)
MEAGSGPPGGPGSESPNRAVEYLLELNNIIESQQQLLETQRRRIEELEGQLDQLTQENRD
LREESQLHRGELHRDPHGARDSPGRESQYQNLRETQFHHRELRESQFHQAARDVGYPNRE
GAYQNREAVYRDKERDASYPLQDTTGYTARERDVAQCHLHHENPALGRERGGREAGPAHP
GREKEAGYSAAVGVGPRPPRERGQLSRGASRSSSPGAGGGHSTSTSTSPATTLQRKSDGE
NSRTVSVEGDAPGSDLSTAVDSPGSQPPYRLSQLPPSSSHMGGPPAGVGLPWAQRARLQP
ASVALRKQEEEEIKRSKALSDSYELSTDLQDKKVEMLERKYGGSFLSRRAARTIQTAFRQ
YRMNKNFERLRSSASESRMSRRIILSNMRMQFSFEEYEKAQNPAYFEGKPASLDEGAMAG
ARSHRLERGLPYGGSCGGGIDGGGSSVTTSGEFSNDITELEDSFSKQVKSLAESIDEALN
CHPSGPMSEEPGSAQLEKRESKEQQEDSSATSFSDLPLYLDDTVPQQSPERLPSTEPPPQ
GRPEFWAPAPLPPVPPPVPSGTREDGSREEGTRRGPGCLECRDFRLRAAHLPLLTIEPPS
DSSVDLSDRSDRGSVHRQLVYEADGCSPHGTLKHKGPPGRAPIPHRHYPAPEGPAPAPPG
PLPPAPNSGTGPSGVAGGRRLGKCEAAGENSDGGDNESLESSSNSNETINCSSGSSSRDS
LREPPATGLCKQTYQRETRHSWDSPAFNNDVVQRRHYRIGLNLFNKKPEKGIQYLIERGF
LSDTPVGVAHFILERKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSSMDLDDALRKF
QSHIRVQGEAQKVERLIEAFSQRYCVCNPALVRQFRNPDTIFILAFAIILLNTDMYSPSV
KAERKMKLDDFIKNLRGVDNGEDIPRDLLVGIYQRIQGRELRTNDDHVSQVQAVERMIVG
KKPVLSLPHRRLVCCCQLYEVPDPNRPQRLGLHQREVFLFNDLLVVTKIFQKKKILVTYS
FRQSFPLVEMHMQLFQNSYYQFGIKLLSAVPGGERKVLIIFNAPSLQDRLRFTSDLRESI
AEVQEMEKYRVESELEKQKGMMRPNASQPGGAKDSVNGTMARSSLEDTYGAGDGLKRGAL
SSSLRDLSDAGKRGRRNSVGSLDSTIEGSVISSPRPHQRMPPPPPPPPPEEYKSQRPVSN
SSSFLGSLFGSKRGKGPFQMPPPPTGQASASSSSASSTHHHHHHHHHGHSHGGLGVLPDG
QSKLQALHAQYCQGPGPAPPPYLPPQQPSLPPPPQQPPPLPQLGSIPPPPASAPPVGPHR
HFHAHGPVPGPQHYTLGRPGRAPRRGAGGHPQFAPHGRHPLHQPTSPLPLYSPAPQHPPA
HKQGPKHFIFSHHPQMMPAAGAAGGPGSRPPGGSYSHPHHPQSPLSPHSPIPPHPSYPPL
PPPSPHTPHSPLPPTSPHGPLHASGPPGTANPPSANPKAKPSRISTVV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5JU85	0.999	0.999	0.000	1488	1.000	1.000	Q5JU85.pdb.gz	IQEC2_HUMAN IQ motif and SEC7 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=IQSEC2 PE=1 SV=2
2	AFDB:Q9VP80	0.276	0.307	8.684E-58	1325	0.243	0.273	Q9VP80.pdb.gz	Q9VP80_DROME FI21420p1 OS=Drosophila melanogaster OX=7227 GN=siz PE=1 SV=2
3	PDB:6bbpA	0.137	0.360	1.623E-21	520	0.063	0.181	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
4	PDB:6u3eA	0.125	0.450	2.928E-20	397	0.064	0.239	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
5	AFDB:Q9VXY2	0.052	0.042	1.591E-10	2084	0.135	0.096	Q9VXY2.pdb.gz	MADD_DROME MAP kinase-activating death domain protein OS=Drosophila melanogaster OX=7227 GN=Rab3-GEF PE=2 SV=2
6	AFDB:A1ZAN6	0.082	0.052	2.645E-8	2559	0.144	0.084	A1ZAN6.pdb.gz	A1ZAN6_DROME Rho guanine nucleotide exchange factor 2, isoform D OS=Drosophila melanogaster OX=7227 GN=RhoGEF2 PE=1 SV=1
7	AFDB:Q6ZNL6	0.089	0.091	4.916E-8	1462	0.099	0.101	Q6ZNL6.pdb.gz	FGD5_HUMAN FYVE, RhoGEF and PH domain-containing protein 5 OS=Homo sapiens OX=9606 GN=FGD5 PE=1 SV=3
8	AFDB:Q96PE2	0.083	0.064	1.983E-7	2063	0.134	0.097	Q96PE2.pdb.gz	ARHGH_HUMAN Rho guanine nucleotide exchange factor 17 OS=Homo sapiens OX=9606 GN=ARHGEF17 PE=1 SV=1
9	AFDB:A0A2R8QD21	0.084	0.066	3.156E-7	1989	0.083	0.062	A0A2R8QD21.pdb.gz
10	AFDB:X2JC00	0.076	0.080	6.177E-7	1404	0.108	0.114	X2JC00.pdb.gz	X2JC00_DROME Rho GTPase activating protein at 1A, isoform E OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=1 SV=1
11	PDB:4mt6A	0.094	0.303	2.492E-6	389	0.034	0.129	4mt6A.pdb.gz
12	AFDB:F4IZM8	0.050	0.053	1.867E-5	1347	0.127	0.140	F4IZM8.pdb.gz	HUAL3_ARATH Protein HUA2-LIKE 3 OS=Arabidopsis thaliana OX=3702 GN=HULK3 PE=2 SV=1
13	AFDB:Q9VVC6	0.077	0.059	2.546E-5	2029	0.121	0.089	Q9VVC6.pdb.gz	Q9VVC6_DROME Ephexin, isoform D OS=Drosophila melanogaster OX=7227 GN=Exn PE=2 SV=3
14	PDB:4gouA	0.083	0.212	5.946E-4	507	0.028	0.081	4gouA.pdb.gz
15	PDB:3uzsA	0.065	0.144	5.480E-3	609	0.032	0.079	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.
16	PDB:1k5dB	0.064	0.414	7.095E-3	146	0.009	0.096	1k5dB.pdb.gz	RanGAP mediates GTP hydrolysis without an arginine finger.
17	PDB:6hhgA	0.060	0.213	1.019E-2	386	0.008	0.031	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
18	PDB:3m1iB	0.064	0.469	2.718E-2	131	0.009	0.107	3m1iB.pdb.gz	An allosteric mechanism to displace nuclear export cargo from CRM1 and RanGTP by RanBP1
19	PDB:6s9wA	0.059	0.197	3.341E-2	411	0.009	0.032	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
20	PDB:6i7sG	0.059	0.087	5.318E-2	863	0.027	0.046	6i7sG.pdb.gz	The crystal structure of human microsomal triglyceride transfer protein.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0C4DGT3	0.0	945	814	0.351	0.643	A0A0C4DGT3_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 GN=IQSEC1 PE=1 SV=1
2	A0A0G2JZX5	0.0	1834	1002	0.604	0.897	A0A0G2JZX5_RAT IQ motif and Sec7 domain ArfGEF 2 OS=Rattus norvegicus OX=10116 GN=Iqsec2 PE=1 SV=2
3	A0A2R8Y695	0.0	773	779	0.310	0.593	A0A2R8Y695_HUMAN IQ motif and Sec7 domain ArfGEF 1 (Fragment) OS=Homo sapiens OX=9606 GN=IQSEC1 PE=1 SV=1
4	A0A2R8Y7T6	0.0	1013	964	0.392	0.606	A0A2R8Y7T6_HUMAN IQ motif and Sec7 domain ArfGEF 1 OS=Homo sapiens OX=9606 GN=IQSEC1 PE=1 SV=1
5	A0A3B3IRZ4	0.0	1051	1222	0.425	0.517	A0A3B3IRZ4_HUMAN IQ motif and Sec7 domain ArfGEF 1 OS=Homo sapiens OX=9606 GN=IQSEC1 PE=1 SV=1
6	A0A8I5Y7S8	0.0	2313	1154	0.763	0.984	A0A8I5Y7S8_RAT IQ motif and Sec7 domain ArfGEF 2 OS=Rattus norvegicus OX=10116 GN=Iqsec2 PE=3 SV=1
7	A0A8I6APH1	0.0	1834	949	0.603	0.946	A0A8I6APH1_RAT IQ motif and Sec7 domain ArfGEF 2 OS=Rattus norvegicus OX=10116 GN=Iqsec2 PE=3 SV=1
8	A0A8I6GKX8	0.0	2972	1488	0.989	0.989	A0A8I6GKX8_RAT IQ motif and Sec7 domain ArfGEF 2 OS=Rattus norvegicus OX=10116 GN=Iqsec2 PE=3 SV=1
9	A4GZ26	0.0	2945	1479	0.984	0.990	A4GZ26_MOUSE ARF6 guanine nucleotide exchange factor IQArfGEF OS=Mus musculus OX=10090 GN=Iqsec2 PE=1 SV=1
10	E7EZE5	0.0	1088	1252	0.418	0.497	E7EZE5_DANRE IQ motif and SEC7 domain-containing protein 1 isoform X1 OS=Danio rerio OX=7955 GN=iqsec1b PE=1 SV=1
11	Q5DU25	0.0	2943	1478	0.983	0.989	IQEC2_MOUSE IQ motif and SEC7 domain-containing protein 2 OS=Mus musculus OX=10090 GN=Iqsec2 PE=1 SV=3
12	Q5JU85	0.0	3008	1488	1.000	1.000	IQEC2_HUMAN IQ motif and SEC7 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=IQSEC2 PE=1 SV=2
13	Q6DN90	0.0	1007	963	0.390	0.603	IQEC1_HUMAN IQ motif and SEC7 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=IQSEC1 PE=1 SV=1
14	Q8R0S2	0.0	1010	961	0.392	0.608	IQEC1_MOUSE IQ motif and SEC7 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Iqsec1 PE=1 SV=2
15	X1WBR0	0.0	1088	1134	0.418	0.549	X1WBR0_DANRE IQ motif and SEC7 domain-containing protein 1 isoform X3 OS=Danio rerio OX=7955 GN=iqsec1b PE=1 SV=2
16	Q9UPP2	5.74e-164	528	1182	0.165	0.207	IQEC3_HUMAN IQ motif and SEC7 domain-containing protein 3 OS=Homo sapiens OX=9606 GN=IQSEC3 PE=2 SV=3
17	Q76M68	4.84e-163	526	1194	0.165	0.206	IQEC3_RAT IQ motif and SEC7 domain-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Iqsec3 PE=1 SV=1
18	Q3TES0	8.13e-163	525	1195	0.175	0.218	IQEC3_MOUSE IQ motif and SEC7 domain-containing protein 3 OS=Mus musculus OX=10090 GN=Iqsec3 PE=1 SV=1
19	Q95U36	1.47e-143	470	1082	0.160	0.220	Q95U36_DROME GH10594p OS=Drosophila melanogaster OX=7227 GN=siz PE=2 SV=1
20	E1JI59	4.50e-143	472	1220	0.160	0.195	E1JI59_DROME Schizo, isoform D OS=Drosophila melanogaster OX=7227 GN=siz PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16453 IQ_SEC7_PH	2.1e-57	204.2	PH domain
2	PF19057 PH_19	1.9e+02	13.1	PH domain
3	PF01369 Sec7	7.6e-56	200.2	Sec7 domain
4	PF04102 SlyX	4.8e+02	12.8	SlyX

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379712

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000440005	0.885	ADP-ribosylation factor 1
2	9606.ENSP00000382428	0.822	Disks large homolog 4
3	9606.ENSP00000403636	0.791	Ras/Rap GTPase-activating protein SynGAP
4	9606.ENSP00000298316	0.738	ADP-ribosylation factor 6
5	9606.ENSP00000480322	0.690	CD99 antigen-like protein 2
6	9606.ENSP00000364550	0.678	Lysine-specific demethylase 5C
7	9606.ENSP00000326948	0.652	Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase
8	9606.ENSP00000168216	0.647	3-hydroxyacyl-CoA dehydrogenase type-2
9	9606.ENSP00000250617	0.638	Rho guanine nucleotide exchange factor 6
10	9606.ENSP00000337168	0.634	Band 4.1-like protein 1
11	9606.ENSP00000245838	0.627	THO complex subunit 2
12	9606.ENSP00000369862	0.621	Collagen type IV alpha-3-binding protein
13	9606.ENSP00000368278	0.620	Interleukin-1 receptor accessory protein-like 1
14	9606.ENSP00000369325	0.602	Cyclin-dependent kinase-like 5
15	9606.ENSP00000381185	0.589	Apoptosis regulator Bcl-2
16	9606.ENSP00000316338	0.584	Brain-specific angiogenesis inhibitor 1-associated protein 2
17	9606.ENSP00000381425	0.583	MAGUK p55 subfamily member 3
18	9606.ENSP00000402394	0.582	Carbohydrate sulfotransferase 15
19	9606.ENSP00000362399	0.562	Syntaxin-binding protein 1
20	9606.ENSP00000477455	0.562	Glutamate receptor ionotropic, NMDA 2B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0098772	0.998	molecular function regulator activity
GO:0030234	0.994	enzyme regulator activity
GO:0140678	0.992	molecular function inhibitor activity
GO:0030695	0.975	GTPase regulator activity
GO:0005085	0.974	guanyl-nucleotide exchange factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0023051	0.984	regulation of signaling
GO:0010646	0.984	regulation of cell communication
GO:0048518	0.981	positive regulation of biological process
GO:0048522	0.973	positive regulation of cellular process
GO:0051966	0.971	regulation of synaptic transmission, glutamatergic
GO:0048167	0.964	regulation of synaptic plasticity
GO:0050806	0.959	positive regulation of synaptic transmission
GO:0051968	0.940	positive regulation of synaptic transmission, glutamatergic
GO:0009987	0.420	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	0.996	intracellular anatomical structure
GO:0005886	0.996	plasma membrane
GO:0043226	0.995	organelle
GO:0045202	0.995	synapse
GO:0005737	0.993	cytoplasm
GO:0043229	0.990	intracellular organelle
GO:0043232	0.980	intracellular non-membrane-bounded organelle
GO:0043231	0.811	intracellular membrane-bounded organelle
GO:0098794	0.539	postsynapse
GO:0098978	0.432	glutamatergic synapse
GO:0070013	0.372	intracellular organelle lumen
GO:0098590	0.362	plasma membrane region
GO:0098685	0.353	Schaffer collateral - CA1 synapse
GO:0099572	0.335	postsynaptic specialization
GO:0031981	0.330	nuclear lumen
GO:0014069	0.315	postsynaptic density

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]