StarFunc result for job id Q5JUK2

User Input

>input (328 residues)
MASRCSEPYPEVSRIPTVRGCNGSLSGALSCCEDSARGSGPPKAPTVAEGPSSCLRRNVI
SERERRKRMSLSCERLRALLPQFDGRREDMASVLEMSVQFLRLASALGPSQEQHAILASS
KEMWHSLQEDVLQLTLSSQIQAGVPDPGTGASSGTRTPDVKAFLESPWSLDPASASPEPV
PHILASSRQWDPASCTSLGTDKCEALLGLCQVRGGLPPFSEPSSLVPWPPGRSLPKAVRP
PLSWPPFSQQQTLPVMSGEALGWLGQAGPLAMGAAPLGEPAKEDPMLAQEAGSALGSDVD
DGTSFLLTAGPSSWPGEWGPGFRAGPPA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5JUK2	1.000	1.000	1.637E-50	328	1.000	1.000	Q5JUK2.pdb.gz	SOLH1_HUMAN Spermatogenesis- and oogenesis-specific basic helix-loop-helix-containing protein 1 OS=Homo sapiens OX=9606 GN=SOHLH1 PE=1 SV=4
2	AFDB:Q6IUP1	0.259	0.243	2.478E-12	357	0.375	0.345	Q6IUP1.pdb.gz	SOLH1_MOUSE Spermatogenesis- and oogenesis-specific basic helix-loop-helix-containing protein 1 OS=Mus musculus OX=10090 GN=Sohlh1 PE=1 SV=1
3	AFDB:Q9NX45	0.183	0.147	1.750E-5	425	0.192	0.148	Q9NX45.pdb.gz	SOLH2_HUMAN Spermatogenesis- and oogenesis-specific basic helix-loop-helix-containing protein 2 OS=Homo sapiens OX=9606 GN=SOHLH2 PE=2 SV=2
4	AFDB:Q9D489	0.210	0.156	1.715E-4	467	0.162	0.113	Q9D489.pdb.gz	SOLH2_MOUSE Spermatogenesis- and oogenesis-specific basic helix-loop-helix-containing protein 2 OS=Mus musculus OX=10090 GN=Sohlh2 PE=1 SV=2
5	AFDB:Q67U21	0.165	0.158	6.841E-4	343	0.177	0.169	Q67U21.pdb.gz	Q67U21_ORYSJ BHLH transcription factor OS=Oryza sativa subsp. japonica OX=39947 GN=Os02g0433600 PE=2 SV=1
6	AFDB:A0A2R8RRI1	0.137	0.095	1.110E-3	493	0.162	0.108	A0A2R8RRI1.pdb.gz	A0A2R8RRI1_DANRE Transcription factor EB OS=Danio rerio OX=7955 GN=tfeb PE=3 SV=1
7	AFDB:A0A024QZ23	0.132	0.081	2.924E-3	575	0.210	0.120	A0A024QZ23.pdb.gz
8	AFDB:P40473	0.104	0.099	7.700E-3	351	0.186	0.174	P40473.pdb.gz	POG1_YEAST Transcriptional activator POG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=POG1 PE=1 SV=1
9	AFDB:B8QI33	0.075	0.028	8.843E-3	1267	0.149	0.039	B8QI33.pdb.gz	B8QI33_MOUSE Liprin-alpha 1 OS=Mus musculus OX=10090 GN=Ppfia1 PE=2 SV=1
10	AFDB:A0A0B4K6W9	0.114	0.053	1.088E-2	898	0.152	0.056	A0A0B4K6W9.pdb.gz	A0A0B4K6W9_DROME Hephaestus, isoform Y OS=Drosophila melanogaster OX=7227 GN=heph PE=1 SV=1
11	PDB:7mqaNA	0.065	0.071	2.024	295	0.082	0.092	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:6bk8L	0.063	0.052	3.284	412	0.030	0.024	6bk8L.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
13	PDB:4aijB	0.104	0.203	4.641	142	0.027	0.063	4aijB.pdb.gz	Structural Basis for Intrinsic Thermosensing by the Master Virulence Regulator Rova of Yersinia.
14	PDB:6zx9C	0.072	0.084	4.641	257	0.049	0.062	6zx9C.pdb.gz	Structural insights into Cullin4-RING ubiquitin ligase remodelling by Vpr from simian immunodeficiency viruses.
15	PDB:6govN	0.093	0.216	6.120	110	0.058	0.173	6govN.pdb.gz	Structural Basis for the Action of an All-Purpose Transcription Anti-termination Factor.
16	PDB:4gwqB	0.113	0.088	6.558	492	0.076	0.051	4gwqB.pdb.gz	Structure of the Mediator Head module bound to the carboxy-terminal domain of RNA polymerase II.
17	PDB:7cgpJ	0.111	0.366	7.531	83	0.040	0.157	7cgpJ.pdb.gz
18	PDB:7mq8LT	0.092	0.046	7.531	869	0.088	0.033	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:1e1cA	0.070	0.034	8.071	727	0.027	0.012	1e1cA.pdb.gz	Protection of Radical Intermediates at the Active Site of Adenosylcobalamin-Dependent Methylmalonyl-Coa Mutase
20	PDB:6tedR	0.093	0.115	8.649	244	0.040	0.053	6tedR.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5JUK2	0.0	642	328	1.000	1.000	SOLH1_HUMAN Spermatogenesis- and oogenesis-specific basic helix-loop-helix-containing protein 1 OS=Homo sapiens OX=9606 GN=SOHLH1 PE=1 SV=4
2	Q6IUP1	3.10e-33	127	357	0.384	0.353	SOLH1_MOUSE Spermatogenesis- and oogenesis-specific basic helix-loop-helix-containing protein 1 OS=Mus musculus OX=10090 GN=Sohlh1 PE=1 SV=1
3	Q9NX45	6.99e-06	49.7	425	0.061	0.047	SOLH2_HUMAN Spermatogenesis- and oogenesis-specific basic helix-loop-helix-containing protein 2 OS=Homo sapiens OX=9606 GN=SOHLH2 PE=2 SV=2
4	Q9D489	5.41e-05	47.0	467	0.058	0.041	SOLH2_MOUSE Spermatogenesis- and oogenesis-specific basic helix-loop-helix-containing protein 2 OS=Mus musculus OX=10090 GN=Sohlh2 PE=1 SV=2
5	Q6Z339	0.001	42.4	344	0.067	0.064	Q6Z339_ORYSJ Os02g0726700 protein OS=Oryza sativa subsp. japonica OX=39947 GN=Os02g0726700 PE=3 SV=1
6	Q9LTS4	0.007	40.4	466	0.110	0.077	BH041_ARATH Putative transcription factor bHLH041 OS=Arabidopsis thaliana OX=3702 GN=BHLH41 PE=3 SV=1
7	Q7XPS7	0.028	38.5	567	0.076	0.044	Q7XPS7_ORYSJ OSJNBa0065O17.4 protein OS=Oryza sativa subsp. japonica OX=39947 GN=OSJNBa0065O17.4 PE=3 SV=2
8	Q653A4	0.034	38.1	396	0.049	0.040	Q653A4_ORYSJ Basic helix-loop-helix-like OS=Oryza sativa subsp. japonica OX=39947 GN=Os06g0526100 PE=3 SV=1
9	Q6ETQ5	0.040	38.1	415	0.055	0.043	Q6ETQ5_ORYSJ Os02g0257500 protein OS=Oryza sativa subsp. japonica OX=39947 GN=Os02g0257500 PE=3 SV=1
10	Q948Y2	0.056	37.4	451	0.055	0.040	Q948Y2_ORYSA R-type basic helix-loop-helix protein OS=Oryza sativa OX=4530 GN=Plw-OSB2 PE=2 SV=1
11	Q9V406	0.076	37.4	631	0.046	0.024	Q9V406_DROME Activator protein 4 OS=Drosophila melanogaster OX=7227 GN=crp PE=1 SV=1
12	Q7TS99	0.11	36.2	240	0.162	0.221	HELT_MOUSE Hairy and enhancer of split-related protein HELT OS=Mus musculus OX=10090 GN=Helt PE=1 SV=1
13	B0V3D4	0.17	34.7	152	0.061	0.132	B0V3D4_DANRE Hairy-related 4, tandem duplicate 2 OS=Danio rerio OX=7955 GN=her4.5 PE=4 SV=1
14	Q9Y5J3	0.17	35.8	304	0.082	0.089	HEY1_HUMAN Hairy/enhancer-of-split related with YRPW motif protein 1 OS=Homo sapiens OX=9606 GN=HEY1 PE=1 SV=1
15	B0V3D1	0.19	34.7	152	0.061	0.132	B0V3D1_DANRE Hairy-related 4, tandem duplicate 2 OS=Danio rerio OX=7955 GN=Hes5d PE=4 SV=1
16	Q90466	0.19	34.7	152	0.061	0.132	Q90466_DANRE HER-4 protein OS=Danio rerio OX=7955 GN=Hes5e PE=2 SV=1
17	B0V3D2	0.20	34.7	152	0.058	0.125	B0V3D2_DANRE Hairy-related 4, tandem duplicate 3 OS=Danio rerio OX=7955 GN=her4.1 PE=4 SV=1
18	Q8H102	0.20	35.8	362	0.046	0.041	BH128_ARATH Transcription factor bHLH128 OS=Arabidopsis thaliana OX=3702 GN=BHLH128 PE=1 SV=1
19	Q86PC0	0.21	35.8	543	0.046	0.028	Q86PC0_DROME RE01132p OS=Drosophila melanogaster OX=7227 GN=crp PE=2 SV=1
20	B0V3D3	0.23	34.3	152	0.061	0.132	B0V3D3_DANRE Hairy-related 4, tandem duplicate 4 OS=Danio rerio OX=7955 GN=si:ch73-21g5.5 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00010 HLH	0.014	26.7	Helix-loop-helix DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000404438

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369210	0.965	Spermatogenesis- and oogenesis-specific basic helix-loop-helix-containing protein 2
2	9606.ENSP00000294638	0.906	LIM/homeobox protein Lhx8
3	9606.ENSP00000007699	0.817	Y-box-binding protein 2
4	9606.ENSP00000297537	0.815	Homeobox protein GBX-1
5	9606.ENSP00000333097	0.773	Factor in the germline alpha
6	9606.ENSP00000419457	0.764	Homeobox protein NOBOX
7	9606.ENSP00000334952	0.756	Adhesion G protein-coupled receptor A3
8	9606.ENSP00000275764	0.697	Stimulated by retinoic acid gene 8 protein homolog
9	9606.ENSP00000341021	0.697	Nanos homolog 2
10	9606.ENSP00000460971	0.668	Zona pellucida sperm-binding protein 2
11	9606.ENSP00000347591	0.649	GDNF family receptor alpha-1
12	9606.ENSP00000367942	0.628	Growth/differentiation factor 9
13	9606.ENSP00000250863	0.626	Deleted in azoospermia-like
14	9606.ENSP00000338157	0.622	Zinc finger and BTB domain-containing protein 16
15	9606.ENSP00000371711	0.621	Doublesex- and mab-3-related transcription factor 1
16	9606.ENSP00000341992	0.617	Nanos homolog 3
17	9606.ENSP00000376658	0.606	Synaptonemal complex protein 3
18	9606.ENSP00000293805	0.603	B-cell CLL/lymphoma 6 member B protein
19	9606.ENSP00000341282	0.602	Synaptonemal complex central element protein 1
20	9606.ENSP00000242462	0.571	Neurogenin-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.920	organic cyclic compound binding
GO:1901363	0.919	heterocyclic compound binding
GO:0003676	0.912	nucleic acid binding
GO:0003677	0.870	DNA binding
GO:0043565	0.706	sequence-specific DNA binding
GO:0003690	0.548	double-stranded DNA binding
GO:1990837	0.506	sequence-specific double-stranded DNA binding
GO:0003700	0.326	DNA-binding transcription factor activity
GO:0000976	0.310	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0006355	0.987	regulation of DNA-templated transcription
GO:0009987	0.983	cellular process
GO:0048856	0.946	anatomical structure development
GO:0032501	0.928	multicellular organismal process
GO:0007275	0.841	multicellular organism development
GO:0048518	0.749	positive regulation of biological process
GO:0048522	0.715	positive regulation of cellular process
GO:0003006	0.682	developmental process involved in reproduction
GO:0019953	0.670	sexual reproduction
GO:0031325	0.598	positive regulation of cellular metabolic process
GO:0010604	0.594	positive regulation of macromolecule metabolic process
GO:0051173	0.588	positive regulation of nitrogen compound metabolic process
GO:0007276	0.569	gamete generation
GO:0007548	0.499	sex differentiation
GO:0048731	0.491	system development
GO:0006357	0.446	regulation of transcription by RNA polymerase II
GO:0045935	0.435	positive regulation of nucleobase-containing compound metabolic process
GO:0030154	0.416	cell differentiation
GO:0010557	0.414	positive regulation of macromolecule biosynthetic process
GO:0031328	0.411	positive regulation of cellular biosynthetic process
GO:0051254	0.409	positive regulation of RNA metabolic process
GO:0045944	0.387	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.959	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]