StarFunc result for job id Q5JUK3

User Input

>input (1230 residues)
MARAKLPRSPSEGKAGPGGAPAGAAAPEEPHGLSPLLPARGGGSVGSDVGQRLPVEDFSL
DSSLSQVQVEFYVNENTFKERLKLFFIKNQRSSLRIRLFNFSLKLLTCLLYIVRVLLDDP
ALGIGCWGCPKQNYSFNDSSSEINWAPILWVERKMTLWAIQVIVAIISFLETMLLIYLSY
KGNIWEQIFRVSFVLEMINTLPFIITIFWPPLRNLFIPVFLNCWLAKHALENMINDFHRA
ILRTQSAMFNQVLILFCTLLCLVFTGTCGIQHLERAGENLSLLTSFYFCIVTFSTVGYGD
VTPKIWPSQLLVVIMICVALVVLPLQFEELVYLWMERQKSGGNYSRHRAQTEKHVVLCVS
SLKIDLLMDFLNEFYAHPRLQDYYVVILCPTEMDVQVRRVLQIPLWSQRVIYLQGSALKD
QDLMRAKMDNGEACFILSSRNEVDRTAADHQTILRAWAVKDFAPNCPLYVQILKPENKFH
VKFADHVVCEEECKYAMLALNCICPATSTLITLLVHTSRGQEGQESPEQWQRMYGRCSGN
EVYHIRMGDSKFFREYEGKSFTYAAFHAHKKYGVCLIGLKREDNKSILLNPGPRHILAAS
DTCFYINITKEENSAFIFKQEEKRKKRAFSGQGLHEGPARLPVHSIIASMGTVAMDLQGT
EHRPTQSGGGGGGSKLALPTENGSGSRRPSIAPVLELADSSALLPCDLLSDQSEDEVTPS
DDEGLSVVEYVKGYPPNSPYIGSSPTLCHLLPVKAPFCCLRLDKGCKHNSYEDAKAYGFK
NKLIIVSAETAGNGLYNFIVPLRAYYRSRKELNPIVLLLDNKPDHHFLEAICCFPMVYYM
EGSVDNLDSLLQCGIIYADNLVVVDKESTMSAEEDYMADAKTIVNVQTMFRLFPSLSITT
ELTHPSNMRFMQFRAKDSYSLALSKLEKRERENGSNLAFMFRLPFAAGRVFSISMLDTLL
YQSFVKDYMITITRLLLGLDTTPGSGYLCAMKITEGDLWIRTYGRLFQKLCSSSAEIPIG
IYRTESHVFSTSESQISVNVEDCEDTREVKGPWGSRAGTGGSSQGRHTGGGDPAEHPLLR
RKSLQWARRLSRKAPKQAGRAAAAEWISQQRLSLYRRSERQELSELVKNRMKHLGLPTTG
YEDVANLTASDVMNRVNLGYLQDEMNDHQNTLSYVLINPPPDTRLEPSDIVYLIRSDPLA
HVASSSQSRKSSCSHKLSSCNPETRDETQL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8DY93	0.737	0.490	0.000	1878	0.520	0.341	A8DY93.pdb.gz	A8DY93_DROME Slowpoke 2, isoform D OS=Drosophila melanogaster OX=7227 GN=SLO2 PE=4 SV=2
2	AFDB:Q9Z258	0.905	0.900	0.000	1237	0.937	0.931	Q9Z258.pdb.gz	KCNT1_RAT Potassium channel subfamily T member 1 OS=Rattus norvegicus OX=10116 GN=Kcnt1 PE=1 SV=1
3	AFDB:H9G2R4	0.552	0.592	2.408E-95	1143	0.378	0.407	H9G2R4.pdb.gz	H9G2R4_CAEEL Ion_trans_2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=slo-2 PE=1 SV=1
4	AFDB:F1QYL4	0.541	0.551	7.350E-44	1205	0.188	0.192	F1QYL4.pdb.gz	F1QYL4_DANRE BK channel OS=Danio rerio OX=7955 GN=kcnma1 PE=3 SV=3
5	AFDB:Q08460	0.539	0.548	4.785E-43	1209	0.193	0.197	Q08460.pdb.gz	KCMA1_MOUSE Calcium-activated potassium channel subunit alpha-1 OS=Mus musculus OX=10090 GN=Kcnma1 PE=1 SV=2
6	AFDB:H7BRC9	0.561	0.592	2.697E-42	1160	0.178	0.189	H7BRC9.pdb.gz	H7BRC9_CAEEL BK channel OS=Caenorhabditis elegans OX=6239 GN=slo-1 PE=1 SV=1
7	AFDB:O54982	0.525	0.571	1.316E-41	1121	0.157	0.172	O54982.pdb.gz	KCNU1_MOUSE Potassium channel subfamily U member 1 OS=Mus musculus OX=10090 GN=Kcnu1 PE=1 SV=2
8	AFDB:A8MYU2	0.522	0.555	7.806E-40	1149	0.157	0.168	A8MYU2.pdb.gz	KCNU1_HUMAN Potassium channel subfamily U member 1 OS=Homo sapiens OX=9606 GN=KCNU1 PE=1 SV=2
9	PDB:7pxeA	0.521	0.697	3.320E-36	885	0.157	0.218	7pxeA.pdb.gz	Small molecule modulation of the Drosophila Slo channel elucidated by cryo-EM.
10	PDB:6u68A	0.190	0.555	2.210E-12	319	0.059	0.226	6u68A.pdb.gz
11	PDB:3rbzA	0.191	0.699	7.728E-11	289	0.052	0.221	3rbzA.pdb.gz	Structures of multiple Ca2+-binding sites in a K+ channel RCK domain
12	AFDB:O54853	0.161	0.197	4.015E-6	950	0.081	0.105	O54853.pdb.gz	KCNH6_RAT Potassium voltage-gated channel subfamily H member 6 OS=Rattus norvegicus OX=10116 GN=Kcnh6 PE=1 SV=1
13	PDB:4j7cB	0.103	0.470	4.215E-5	217	0.024	0.138	4j7cB.pdb.gz	The structure of the KtrAB potassium transporter
14	PDB:7f3fA	0.099	0.219	1.213E-4	460	0.034	0.091	7f3fA.pdb.gz
15	PDB:7w6sB	0.105	0.241	1.960E-4	448	0.035	0.096	7w6sB.pdb.gz
16	PDB:7phhA	0.099	0.260	2.376E-4	396	0.044	0.136	7phhA.pdb.gz
17	AFDB:Q9JK97	0.099	0.159	2.622E-4	696	0.049	0.086	Q9JK97.pdb.gz	KCNQ4_MOUSE Potassium voltage-gated channel subfamily KQT member 4 OS=Mus musculus OX=10090 GN=Kcnq4 PE=2 SV=2
18	PDB:7sizB	0.092	0.270	9.566E-4	334	0.036	0.132	7sizB.pdb.gz	Structural basis for C-type inactivation in a Shaker family voltage-gated K + channel.
19	PDB:7wswA	0.144	0.328	2.165E-3	472	0.041	0.106	7wswA.pdb.gz
20	PDB:7rhsD	0.139	0.327	2.271E-3	441	0.053	0.147	7rhsD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4JD38	793	1788	0.290	0.200	A0A0B4JD38_DROME Slowpoke 2, isoform F OS=Drosophila melanogaster OX=7227 GN=SLO2 PE=4 SV=1
2	A0A0B4K738	796	1438	0.293	0.251	A0A0B4K738_DROME Slowpoke 2, isoform H OS=Drosophila melanogaster OX=7227 GN=SLO2 PE=4 SV=1
3	A0A0B4KEJ9	796	1727	0.293	0.208	A0A0B4KEJ9_DROME Slowpoke 2, isoform O OS=Drosophila melanogaster OX=7227 GN=SLO2 PE=4 SV=1
4	A0A0B4KEQ3	796	1742	0.293	0.207	A0A0B4KEQ3_DROME Slowpoke 2, isoform I OS=Drosophila melanogaster OX=7227 GN=SLO2 PE=4 SV=1
5	A0A0B4KF87	793	1732	0.290	0.206	A0A0B4KF87_DROME Slowpoke 2, isoform N OS=Drosophila melanogaster OX=7227 GN=SLO2 PE=4 SV=1
6	A0A0B4KFK3	792	1624	0.291	0.220	A0A0B4KFK3_DROME Slowpoke 2, isoform L OS=Drosophila melanogaster OX=7227 GN=SLO2 PE=4 SV=1
7	A0A0C4DHC4	797	1707	0.293	0.211	A0A0C4DHC4_DROME Slowpoke 2, isoform G OS=Drosophila melanogaster OX=7227 GN=SLO2 PE=4 SV=1
8	A8DY93	793	1878	0.291	0.191	A8DY93_DROME Slowpoke 2, isoform D OS=Drosophila melanogaster OX=7227 GN=SLO2 PE=4 SV=2
9	A8DY94	793	1774	0.291	0.202	A8DY94_DROME Slowpoke 2, isoform E OS=Drosophila melanogaster OX=7227 GN=SLO2 PE=4 SV=2
10	B2MZB8	862	1116	0.367	0.404	B2MZB8_CAEEL Ion_trans_2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=slo-2 PE=1 SV=1
11	G5ECD1	861	1119	0.365	0.401	G5ECD1_CAEEL Ion_trans_2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=slo-2 PE=1 SV=1
12	G5EDJ1	862	1107	0.365	0.406	G5EDJ1_CAEEL Ion_trans_2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=slo-2 PE=1 SV=1
13	H9G2R3	860	1125	0.365	0.399	H9G2R3_CAEEL Ion_trans_2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=slo-2 PE=1 SV=1
14	H9G2R4	862	1143	0.365	0.393	H9G2R4_CAEEL Ion_trans_2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=slo-2 PE=1 SV=1
15	H9G2R6	861	1140	0.365	0.394	H9G2R6_CAEEL Ion_trans_2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=slo-2 PE=1 SV=1
16	H9G2R7	862	1130	0.365	0.397	H9G2R7_CAEEL Ion_trans_2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=slo-2 PE=1 SV=1
17	Q565B7	859	1086	0.365	0.413	Q565B7_CAEEL Ion_trans_2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=slo-2 PE=1 SV=1
18	Q6UVM3	1783	1135	0.708	0.767	KCNT2_HUMAN Potassium channel subfamily T member 2 OS=Homo sapiens OX=9606 GN=KCNT2 PE=1 SV=1
19	Q6UVM4	1786	1142	0.714	0.769	KCNT2_RAT Potassium channel subfamily T member 2 OS=Rattus norvegicus OX=10116 GN=Kcnt2 PE=1 SV=1
20	Q9Z258	2332	1237	0.937	0.932	KCNT1_RAT Potassium channel subfamily T member 1 OS=Rattus norvegicus OX=10116 GN=Kcnt1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03493 BK_channel_a	1.9e-24	97.2	Calcium-activated BK potassium channel alpha subunit
2	PF07885 Ion_trans_2	1.6e-08	45.7	Ion channel
3	PF02080 TrkA_C	3.9e+02	12.3	TrkA-C domain
4	PF17065 UPF0669	5.3e+02	11.8	Putative cytokine, C6ORF120

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000011791

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000012437	0.607	Potassium voltage-gated channel, KQT-like subfamily, member 2
2	60711.ENSCSAP00000011525	0.580	Sodium channel, voltage-gated, type I, alpha subunit
3	60711.ENSCSAP00000011751	0.558	Glycosyltransferase 6 domain containing 1
4	60711.ENSCSAP00000004829	0.542	DEP domain containing 5
5	60711.ENSCSAP00000011566	0.532	Mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which Na(+) ions may pass in accordance with their electrochemical gradient.
6	60711.ENSCSAP00000008669	0.518	Belongs to the protein kinase superfamily.
7	60711.ENSCSAP00000006163	0.517	Potassium voltage-gated channel, KQT-like subfamily, member 3
8	60711.ENSCSAP00000010984	0.517	Pleckstrin
9	60711.ENSCSAP00000014257	0.511	annotation not available
10	60711.ENSCSAP00000011126	0.502	Carboxylic ester hydrolase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005267	0.997	potassium channel activity
GO:0022839	0.996	monoatomic ion gated channel activity
GO:0005488	0.806	binding
GO:0005515	0.698	protein binding
GO:0005249	0.426	voltage-gated potassium channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006810	0.991	transport
GO:0030001	0.975	metal ion transport
GO:0006813	0.955	potassium ion transport
GO:0009987	0.935	cellular process
GO:0034220	0.639	monoatomic ion transmembrane transport
GO:0098660	0.624	inorganic ion transmembrane transport
GO:0098662	0.572	inorganic cation transmembrane transport
GO:0098655	0.570	monoatomic cation transmembrane transport
GO:0071805	0.414	potassium ion transmembrane transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005886	0.994	plasma membrane
GO:0005622	0.551	intracellular anatomical structure

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29463	0.997	K(+)(in) = K(+)(out)

[back to server]