StarFunc result for job id Q5JUR7

User Input

>input (227 residues)
MSHTEVKLKIPFGNKLLDAVCLVPNKSLTYGIILTHGASGDMNLPHLMSLASHLASHGFF
CLRFTCKGLNIVHRIKAYKSVLNYLKTSGEYKLAGVFLGGRSMGSRAAASVMCHIEPDDG
DDFVRGLICISYPLHHPKQQHKLRDEDLFRLKEPVLFVSGSADEMCEKNLLEKVAQKMQA
PHKIHWIEKANHSMAVKGRSTNDVFKEINTQILFWIQEITEMDKKCH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P96267	0.706	0.762	2.065E-14	209	0.181	0.196	P96267.pdb.gz	P96267_MYCTU KANL3/Tex30 alpha/beta hydrolase-like domain-containing protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0421c PE=1 SV=1
2	AFDB:Q9SN79	0.710	0.537	2.302E-13	309	0.203	0.149	Q9SN79.pdb.gz	Q9SN79_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=F1P2.140 PE=1 SV=1
3	AFDB:Q9ZUN7	0.757	0.533	8.436E-13	332	0.211	0.145	Q9ZUN7.pdb.gz	Q9ZUN7_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At2g19550 PE=4 SV=1
4	AFDB:Q24JN1	0.709	0.552	1.300E-12	297	0.181	0.138	Q24JN1.pdb.gz	Q24JN1_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At5g11910 PE=1 SV=1
5	AFDB:O04083	0.780	0.560	1.885E-12	324	0.176	0.123	O04083.pdb.gz	O04083_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MAGL1 PE=1 SV=1
6	AFDB:Q8VYJ0	0.733	0.450	2.005E-12	382	0.176	0.105	Q8VYJ0.pdb.gz	Q8VYJ0_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MAGL2 PE=1 SV=1
7	AFDB:Q9C942	0.791	0.556	2.413E-12	332	0.176	0.120	Q9C942.pdb.gz	CSE_ARATH Caffeoylshikimate esterase OS=Arabidopsis thaliana OX=3702 GN=CSE PE=1 SV=1
8	AFDB:Q8RXN7	0.804	0.588	4.211E-12	317	0.163	0.117	Q8RXN7.pdb.gz	Q8RXN7_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MAGL8 PE=1 SV=1
9	AFDB:B3H7N1	0.747	0.476	5.069E-12	369	0.167	0.103	B3H7N1.pdb.gz	B3H7N1_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MAGL15 PE=1 SV=1
10	AFDB:P9WHK1	0.764	0.405	6.102E-12	443	0.154	0.079	P9WHK1.pdb.gz	Y0571_MYCTU Putative phosphoribosyl transferase Rv0571c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0571c PE=1 SV=1
11	PDB:5xb6A	0.708	0.536	5.761E-11	306	0.207	0.154	5xb6A.pdb.gz
12	PDB:7prmA	0.764	0.598	6.936E-11	295	0.176	0.136	7prmA.pdb.gz	Development of High Brain-Penetrant and Reversible Monoacylglycerol Lipase PET Tracers for Neuroimaging.
13	PDB:6eicB	0.720	0.596	1.137E-10	279	0.137	0.111	6eicB.pdb.gz
14	PDB:5xg0C	0.642	0.555	1.550E-10	268	0.154	0.131	5xg0C.pdb.gz
15	PDB:7qvhB	0.675	0.575	1.550E-10	272	0.163	0.136	7qvhB.pdb.gz
16	PDB:3aikA	0.647	0.535	2.389E-10	283	0.172	0.138	3aikA.pdb.gz
17	PDB:4cg3A	0.610	0.535	3.254E-10	263	0.141	0.122	4cg3A.pdb.gz
18	PDB:5hfnD	0.573	0.476	9.311E-10	283	0.159	0.127	5hfnD.pdb.gz
19	PDB:3m83A	0.602	0.441	1.955E-9	325	0.167	0.117	3m83A.pdb.gz	Functional and structural characterization of a thermostable acetyl esterase from Thermotoga maritima.
20	PDB:1imjA	0.696	0.754	2.664E-9	208	0.159	0.173	1imjA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P96267	6.07e-08	53.5	209	0.207	0.225	P96267_MYCTU KANL3/Tex30 alpha/beta hydrolase-like domain-containing protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0421c PE=1 SV=1
2	A2RSY1	0.002	41.2	903	0.159	0.040	KANL3_MOUSE KAT8 regulatory NSL complex subunit 3 OS=Mus musculus OX=10090 GN=Kansl3 PE=1 SV=1
3	Q9P2N6	0.002	41.2	904	0.159	0.040	KANL3_HUMAN KAT8 regulatory NSL complex subunit 3 OS=Homo sapiens OX=9606 GN=KANSL3 PE=1 SV=2
4	H7C4E0	0.77	32.7	209	0.115	0.124	H7C4E0_HUMAN Monoglyceride lipase (Fragment) OS=Homo sapiens OX=9606 GN=MGLL PE=1 SV=1
5	Q99685	0.85	32.7	303	0.115	0.086	MGLL_HUMAN Monoglyceride lipase OS=Homo sapiens OX=9606 GN=MGLL PE=1 SV=2
6	A0A0C4DFN3	0.94	32.7	313	0.115	0.083	A0A0C4DFN3_HUMAN Monoglyceride lipase OS=Homo sapiens OX=9606 GN=MGLL PE=1 SV=1
7	Q5B7T4	1.2	32.7	938	0.141	0.034	MICA_EMENI Microperfuranone synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=micA PE=3 SV=1
8	Q8Y783	1.4	32.3	439	0.115	0.059	Q8Y783_LISMO Putative peptidoglycan bound protein (LPXTG motif) OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) OX=169963 GN=lmo1413 PE=4 SV=1
9	F4HYC8	2.0	31.6	315	0.066	0.048	F4HYC8_ARATH Carboxymethylenebutenolidase homolog OS=Arabidopsis thaliana OX=3702 GN=At1g35420 PE=1 SV=1
10	A1Z9L0	4.3	30.8	1001	0.101	0.023	A1Z9L0_DROME LD05087p OS=Drosophila melanogaster OX=7227 GN=Rcd1 PE=1 SV=1
11	A1Z9L2	4.3	30.8	934	0.101	0.025	A1Z9L2_DROME Reduction in Cnn dots 1, isoform C OS=Drosophila melanogaster OX=7227 GN=Rcd1 PE=1 SV=1
12	A0A0B4KEP1	4.4	30.8	1066	0.101	0.022	A0A0B4KEP1_DROME Reduction in Cnn dots 1, isoform D OS=Drosophila melanogaster OX=7227 GN=Rcd1 PE=1 SV=1
13	A0A0B4KF25	4.4	30.8	1131	0.101	0.020	A0A0B4KF25_DROME Reduction in Cnn dots 1, isoform E OS=Drosophila melanogaster OX=7227 GN=Rcd1 PE=1 SV=1
14	A0A0B4KFM5	4.4	30.8	1111	0.101	0.021	A0A0B4KFM5_DROME Reduction in Cnn dots 1, isoform G OS=Drosophila melanogaster OX=7227 GN=Rcd1 PE=1 SV=1
15	A0A0B4KFX4	4.4	30.8	1046	0.101	0.022	A0A0B4KFX4_DROME Reduction in Cnn dots 1, isoform F OS=Drosophila melanogaster OX=7227 GN=Rcd1 PE=1 SV=1
16	A0A0B4LFC1	4.4	30.8	1108	0.101	0.021	A0A0B4LFC1_DROME Reduction in Cnn dots 1, isoform H OS=Drosophila melanogaster OX=7227 GN=Rcd1 PE=1 SV=1
17	Q8T076	4.4	30.8	1066	0.101	0.022	Q8T076_DROME LD22513p OS=Drosophila melanogaster OX=7227 GN=Rcd1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00561 Abhydrolase_1	5.7e+02	11.5	alpha/beta hydrolase fold
2	PF20408 Abhydrolase_11	2.1e-23	94.6	Alpha/beta hydrolase domain
3	PF08386 Abhydrolase_4	1.8e+02	13.7	TAP-like protein
4	PF12695 Abhydrolase_5	1.2	20.3	Alpha/beta hydrolase family
5	PF01738 DLH	0.011	26.9	Dienelactone hydrolase family
6	PF03959 FSH1	7	17.8	Serine hydrolase (FSH1)
7	PF12146 Hydrolase_4	0.098	23.4	Serine aminopeptidase, S33
8	PF00326 Peptidase_S9	3.3e+02	12.2	Prolyl oligopeptidase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010351386.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010387348.1	0.951	KAT8 regulatory NSL complex subunit 1
2	61622.XP_010383692.1	0.943	Microspherule protein 1 isoform X1
3	61622.XP_010352475.1	0.921	KAT8 regulatory NSL complex subunit 2 isoform X1
4	61622.XP_010353226.1	0.829	KAT8 regulatory NSL complex subunit 1 like
5	61622.XP_010352793.1	0.826	Male specific lethal 1 homolog
6	61622.XP_010367709.1	0.799	Transcriptional adapter 3
7	61622.XP_010363587.1	0.781	MRG/MORF4L-binding protein
8	61622.XP_010363130.1	0.777	Male-specific lethal 2 homolog (Drosophila)
9	61622.XP_010386996.1	0.777	SAGA-associated factor 29 homolog
10	61622.XP_010387001.1	0.777	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: substituted 2 bases at 2 genomic stop codons
11	61622.XP_010354947.1	0.776	Proposed core component of the chromatin remodeling Ino80 complex which exhibits DNA- and nucleosome-activated ATPase activity and catalyzes ATP-dependent nucleosome sliding.
12	61622.XP_010366915.1	0.773	Proposed core component of the chromatin remodeling Ino80 complex which exhibits DNA- and nucleosome-activated ATPase activity and catalyzes ATP-dependent nucleosome sliding.
13	61622.XP_010370213.1	0.766	DNA methyltransferase 1-associated protein 1 isoform X1
14	61622.XP_010386381.1	0.759	Bromodomain-containing protein 8 isoform X1
15	61622.XP_010355592.1	0.750	Host cell factor C2
16	61622.XP_010360028.1	0.750	Host cell factor 1 isoform X1
17	61622.XP_010357701.1	0.740	Transformation/transcription domain-associated protein-like
18	61622.XP_010374056.1	0.740	Belongs to the PI3/PI4-kinase family.
19	61622.XP_010367227.1	0.721	DExH-box helicase 9
20	61622.XP_010355720.1	0.717	PHD finger protein 13

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016787	0.996	hydrolase activity
GO:0016788	0.885	hydrolase activity, acting on ester bonds
GO:0052689	0.772	carboxylic ester hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.972	cellular process
GO:0071704	0.779	organic substance metabolic process
GO:0050789	0.710	regulation of biological process
GO:0044238	0.682	primary metabolic process
GO:0050794	0.528	regulation of cellular process
GO:0006807	0.526	nitrogen compound metabolic process
GO:0043170	0.457	macromolecule metabolic process
GO:0044237	0.444	cellular metabolic process
GO:0019222	0.376	regulation of metabolic process
GO:0060255	0.350	regulation of macromolecule metabolic process
GO:0080090	0.308	regulation of primary metabolic process
GO:0031323	0.308	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005634	0.997	nucleus
GO:0070013	0.985	intracellular organelle lumen
GO:0005829	0.976	cytosol
GO:0031981	0.917	nuclear lumen
GO:0032991	0.880	protein-containing complex
GO:0005654	0.657	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.996	Hydrolases.
EC:3.1.-.-	0.885	Acting on ester bonds.
EC:3.1.1.-	0.772	Carboxylic ester hydrolases.

[back to server]