StarFunc result for job id Q5JV73

User Input

>input (1810 residues)
METLDSQRVQDRLLAAPGCSSPSGQQELFSSHVMQEESANDMECEQLPAEILRQVTVHRD
PIYGFGFVAGSERPVVVRSVRPGGPSENKLLAGDQIVAINEEDVSEAPRERLIELIRSAK
EFIVLTVLHTHQSPKSAFISAAKKAKLRSNPVKVRFSEQVAVGETDAKMMKKEALLLIPN
VLKVFLENGQIKSFTFDGRTTVKDVMLTLQDRLSLRFIEHFALVLEYAGPEQNHKFLLLQ
DKQPLAYVVQRTHYHGMKCLFRISFFPKDPVELLRRDPAAFEYLYIQSRNDVIRERFGMD
PKPEMLLGLAALHIYITVSATRPSQKISLKNVEKEWGLEPFLPPSLLQVIKEKNLRKSLS
QQLKAHQTHPSCGTKGSAIQAKLQYLRILNELPTFTGVLFNTVGLDEKQSATTLLVGPRH
GISHVIDLKTNLTTVLSEFSKISKIQLFRENQGVARVETSIMDAKPLVLLMEWPEATNFA
CLIAGYCRLLLDSRKMVFSRPASQPLPPPMIKADYMHSAHRPVTGGHLGKKESSYVGSVG
TSPRKSSRCTPPPADSELVSFCYLHMREQRKEQESRTDVNENLIFFEETRPRTKSDPTSK
SSGQGYEVVPDDFDAASLDHEPCASRARSYTLDNSLGAEALNFYCDSCKAKLQEQLGPRK
GGKPGSSRDNIVDLMSLPPPGSEEEEEEEDETTSLLPAIAAPPPGFRDNSSDEDDPKRRA
VQSQEQGRHLRGLLYDEIPVTLIDSVQTRTVRDHAQELDDALVSTLQALEALAASEDGPH
PPPPQTAGLIVLATITPESSLDSGHETNSSELTDMSEMMSAMKQHQNTTYFLAQHLNKDS
LLARKDLPFRIQSCAAQAVLTAPYSLGRPDPNPSLQPIATGQSPGPPGARRKLPQSEGQV
QGERTYSLAVHPALSPQLSEQKNLSLLSPVPEDKGPGHTRAGLEMSLRAATSSLSEEQVS
ELRDNLPKEVRLSPKLILDPKSSVTPAIISAALQQVVHNKSLVTAGGALGNPPSRGERRL
EASMGRPEVSMMSSSASKNLKFKISPSAPETSWNSQHQLGAEVSSSPRAPTGSRADSLHL
SQQEDSLPVQNFPPKSYLLRTSRESVGKQATGEVAGKGGPVGGKPTLQKQGTISSQGEKA
QLESTPKRSKLEETSLVPRATYPMALQSPSCQSRSHSPSCQPHGHSPSSQSRGQSPSCQP
RGQSPLRSQAASRQVSTMPSRKLETTLNGAHSTSEGPAKPKSSRGPFRLRNLFSATFPTR
QKKETDERQAQLQKVKQYELEFLEELLKPPSQGELPGTEYLQPPAPGRCSCQLRSSPVQQ
GPGMSREQRRSCDCKRICRGGRPQATQTPVPSLRGRERDRVLPSQRQPEAGPGVSLSSPI
NVQRIRSTSLESRECRSDPESGVSCLTTCASGGECLGAPNYRKLMRRYSISELDQGDRAS
LTSDVYPHPPLGMLPREAKEVEASLPIALGPKSRSLESPTLGDPSYVQVAPETKGPRQMA
VFSLPEEVYRKPAELDEDSESSKCCSIRYCFYYRKCDMADDASDGKDELSYSIPMKILPG
MKLDEQVVPVVSRTLQVLDAATCSSSSPEASRTQEIDLRVSTFEGSLAKINALRAHAYGL
PDGFLAARLDTNELLTVLRQCVASPEARAPKPYVSQISEYKLELALKFKELRASCRRVAN
VDKSPTHMLAAITGSFQVLSSLIETFVRLVFIVRSEAQRQELLAKVEEVVRNYTFLLRAA
EESTARNLNQQQQQQQQQQQQQQQQQQQQQQQQQQQVAAAAGAATEHPPGSPTSATVMST
FTHSLKTLIK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5JV73	1.000	1.000	0.000	1810	1.000	1.000	Q5JV73.pdb.gz	FRPD3_HUMAN FERM and PDZ domain-containing protein 3 OS=Homo sapiens OX=9606 GN=FRMPD3 PE=2 SV=2
2	AFDB:D4A3K7	0.213	0.225	1.798E-63	1705	0.276	0.293	D4A3K7.pdb.gz	D4A3K7_RAT FERM and PDZ domain containing 4 OS=Rattus norvegicus OX=10116 GN=Frmpd4 PE=4 SV=2
3	AFDB:Q5SYB0	0.185	0.211	7.054E-51	1578	0.222	0.254	Q5SYB0.pdb.gz	FRPD1_HUMAN FERM and PDZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FRMPD1 PE=1 SV=1
4	AFDB:Q14CM0	0.221	0.293	2.242E-49	1322	0.214	0.293	Q14CM0.pdb.gz	FRPD4_HUMAN FERM and PDZ domain-containing protein 4 OS=Homo sapiens OX=9606 GN=FRMPD4 PE=1 SV=1
5	AFDB:D3ZW88	0.178	0.233	1.226E-36	1371	0.192	0.253	D3ZW88.pdb.gz	D3ZW88_RAT FERM and PDZ domain containing 1 OS=Rattus norvegicus OX=10116 GN=Frmpd1 PE=4 SV=3
6	PDB:4rm8A	0.142	0.604	8.497E-11	368	0.031	0.155	4rm8A.pdb.gz
7	AFDB:Q9Y4G8	0.053	0.060	2.734E-9	1499	0.086	0.104	Q9Y4G8.pdb.gz	RPGF2_HUMAN Rap guanine nucleotide exchange factor 2 OS=Homo sapiens OX=9606 GN=RAPGEF2 PE=1 SV=1
8	PDB:7c3mA	0.132	0.377	6.712E-6	577	0.034	0.106	7c3mA.pdb.gz
9	AFDB:F2Z3U3	0.065	0.086	5.212E-5	1266	0.107	0.152	F2Z3U3.pdb.gz	F2Z3U3_MOUSE Ras association (RalGDS/AF-6) and pleckstrin homology domains 1 OS=Mus musculus OX=10090 GN=Raph1 PE=1 SV=2
10	AFDB:Q13796	0.055	0.060	1.550E-4	1616	0.140	0.157	Q13796.pdb.gz	SHRM2_HUMAN Protein Shroom2 OS=Homo sapiens OX=9606 GN=SHROOM2 PE=1 SV=1
11	AFDB:P39447	0.049	0.051	3.998E-4	1745	0.111	0.115	P39447.pdb.gz	ZO1_MOUSE Tight junction protein ZO-1 OS=Mus musculus OX=10090 GN=Tjp1 PE=1 SV=2
12	AFDB:A0A1D5NS76	0.056	0.052	5.067E-4	2005	0.112	0.101	A0A1D5NS76.pdb.gz
13	PDB:7qqnC	0.053	0.187	8.838E-4	414	0.031	0.135	7qqnC.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
14	PDB:7pe9I	0.042	0.234	1.886E-3	317	0.010	0.060	7pe9I.pdb.gz	Regulation of human mTOR complexes by DEPTOR.
15	PDB:2xkxA	0.043	0.106	1.978E-3	721	0.012	0.029	2xkxA.pdb.gz
16	PDB:7p70A	0.051	0.195	4.641E-3	407	0.027	0.120	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
17	PDB:7qqmA	0.045	0.182	5.881E-3	413	0.025	0.111	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
18	PDB:7pc3A	0.056	0.199	7.815E-3	405	0.025	0.111	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
19	PDB:7pcbA	0.042	0.176	1.039E-2	415	0.014	0.060	7pcbA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
20	PDB:5n7dA	0.049	0.196	1.089E-2	423	0.025	0.109	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5JV73	0.0	3695	1810	1.000	1.000	FRPD3_HUMAN FERM and PDZ domain-containing protein 3 OS=Homo sapiens OX=9606 GN=FRMPD3 PE=2 SV=2
2	Q14CM0	3.43e-163	536	1322	0.146	0.200	FRPD4_HUMAN FERM and PDZ domain-containing protein 4 OS=Homo sapiens OX=9606 GN=FRMPD4 PE=1 SV=1
3	A0A8I6ALF4	4.35e-162	533	1317	0.146	0.200	A0A8I6ALF4_RAT FERM and PDZ domain containing 4 OS=Rattus norvegicus OX=10116 GN=Frmpd4 PE=4 SV=1
4	A0A8I6GKT4	4.78e-159	533	1705	0.143	0.151	A0A8I6GKT4_RAT FERM and PDZ domain containing 4 OS=Rattus norvegicus OX=10116 GN=Frmpd4 PE=4 SV=1
5	D4A3K7	1.05e-158	534	1777	0.146	0.149	D4A3K7_RAT FERM and PDZ domain containing 4 OS=Rattus norvegicus OX=10116 GN=Frmpd4 PE=4 SV=2
6	A0A8I6ALA6	1.06e-158	533	1759	0.146	0.150	A0A8I6ALA6_RAT FERM and PDZ domain containing 4 OS=Rattus norvegicus OX=10116 GN=Frmpd4 PE=4 SV=1
7	Q5SYB0	3.55e-103	368	1578	0.107	0.122	FRPD1_HUMAN FERM and PDZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FRMPD1 PE=1 SV=1
8	D3ZW88	4.33e-101	361	1549	0.106	0.123	D3ZW88_RAT FERM and PDZ domain containing 1 OS=Rattus norvegicus OX=10116 GN=Frmpd1 PE=4 SV=3
9	A0A2R8RR02	5.47e-13	77.0	1101	0.043	0.071	A0A2R8RR02_DANRE non-specific protein-tyrosine kinase OS=Danio rerio OX=7955 GN=fak PE=1 SV=1
10	Q98SN4	6.79e-13	76.6	1050	0.043	0.074	Q98SN4_DANRE non-specific protein-tyrosine kinase OS=Danio rerio OX=7955 GN=fak1a PE=1 SV=1
11	P34152	5.01e-12	73.9	1052	0.041	0.071	FAK1_MOUSE Focal adhesion kinase 1 OS=Mus musculus OX=10090 GN=Ptk2 PE=1 SV=4
12	Q00944	5.10e-12	73.9	1053	0.048	0.083	FAK1_CHICK Focal adhesion kinase 1 OS=Gallus gallus OX=9031 GN=PTK2 PE=1 SV=2
13	E7ESA6	9.44e-12	72.8	1096	0.041	0.068	E7ESA6_HUMAN non-specific protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=PTK2 PE=1 SV=1
14	Q05397	1.07e-11	72.8	1052	0.041	0.071	FAK1_HUMAN Focal adhesion kinase 1 OS=Homo sapiens OX=9606 GN=PTK2 PE=1 SV=2
15	H0YBP1	1.88e-11	72.0	1017	0.041	0.074	H0YBP1_HUMAN non-specific protein-tyrosine kinase (Fragment) OS=Homo sapiens OX=9606 GN=PTK2 PE=1 SV=1
16	O35346	2.92e-11	71.2	1055	0.041	0.070	FAK1_RAT Focal adhesion kinase 1 OS=Rattus norvegicus OX=10116 GN=Ptk2 PE=1 SV=1
17	Q14289	3.72e-10	67.8	1009	0.041	0.073	FAK2_HUMAN Protein-tyrosine kinase 2-beta OS=Homo sapiens OX=9606 GN=PTK2B PE=1 SV=2
18	Q9QVP9	2.91e-09	64.7	1009	0.038	0.067	FAK2_MOUSE Protein-tyrosine kinase 2-beta OS=Mus musculus OX=10090 GN=Ptk2b PE=1 SV=2
19	P70600	3.98e-09	64.3	1009	0.038	0.067	FAK2_RAT Protein-tyrosine kinase 2-beta OS=Rattus norvegicus OX=10116 GN=Ptk2b PE=1 SV=1
20	B7YZL9	4.85e-07	57.8	1500	0.037	0.045	B7YZL9_DROME Focal adhesion kinase, isoform D OS=Drosophila melanogaster OX=7227 GN=Fak PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16118 DUF4834	1.5e+02	14.7	Domain of unknown function (DUF4834)
2	PF17261 DUF5327	2.1e+02	14.0	Family of unknown function (DUF5327)
3	PF19805 DUF6288	8.7e+02	10.4	Family of unknown function (DUF6288)
4	PF18377 FERM_F2	9.9	17.5	FERM F2 acyl-CoA binding protein-like domain
5	PF00373 FERM_M	3.6e-13	61.3	FERM central domain
6	PF00595 PDZ	4.8e-06	38.2	PDZ domain
7	PF13180 PDZ_2	0.64	21.7	PDZ domain
8	PF17820 PDZ_6	0.0048	28.1	PDZ domain
9	PF02163 Peptidase_M50	4.7e+02	11.4	Peptidase family M50
10	PF07160 SKA1	3.1e+02	12.6	Spindle and kinetochore-associated protein 1
11	PF08351 TmcA_N	4.2e+02	12.1	tRNA(Met) cytidine acetyltransferase TmcA, N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000276185

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000323688	0.674	Olfactory receptor 5T2
2	9606.ENSP00000344241	0.647	Zinc finger matrin-type 5
3	9606.ENSP00000364035	0.612	Fatty-acid amide hydrolase 2
4	9606.ENSP00000256366	0.602	Synaptojanin-2-binding protein
5	9606.ENSP00000335261	0.596	Trimethyllysine dioxygenase, mitochondrial
6	9606.ENSP00000210633	0.586	Semaphorin-4G
7	9606.ENSP00000439937	0.563	Homer protein homolog 3
8	9606.ENSP00000374237	0.553	NXPE family member 2
9	9606.ENSP00000316532	0.551	Transmembrane protein 132E
10	9606.ENSP00000345001	0.520	CREB-regulated transcription coactivator 1
11	9606.ENSP00000288462	0.519	Uncharacterized protein C9orf43
12	9606.ENSP00000417914	0.510	Ankyrin repeat and SOCS box protein 11
13	9606.ENSP00000247003	0.509	Probable ATP-dependent RNA helicase DDX49
14	9606.ENSP00000378400	0.502	LIM domain and actin-binding protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0065007	0.843	biological regulation
GO:0050789	0.727	regulation of biological process
GO:0071840	0.541	cellular component organization or biogenesis
GO:0050794	0.503	regulation of cellular process
GO:0030029	0.488	actin filament-based process
GO:0016043	0.353	cellular component organization
GO:0007010	0.309	cytoskeleton organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0005886	0.998	plasma membrane
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0098588	0.986	bounding membrane of organelle
GO:0031410	0.985	cytoplasmic vesicle
GO:0012505	0.965	endomembrane system
GO:0030667	0.956	secretory granule membrane
GO:0070821	0.874	tertiary granule membrane
GO:0030054	0.378	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]