StarFunc result for job id Q5JVF3

User Input

>input (399 residues)
MAHITINQYLQQVYEAIDSRDGASCAELVSFKHPHVANPRLQMASPEEKCQQVLEPPYDE
MFAAHLRCTYAVGNHDFIEAYKCQTVIVQSFLRAFQAHKEENWALPVMYAVALDLRVFAN
NADQQLVKKGKSKVGDMLEKAAELLMSCFRVCASDTRAGIEDSKKWGMLFLVNQLFKIYF
KINKLHLCKPLIRAIDSSNLKDDYSTAQRVTYKYYVGRKAMFDSDFKQAEEYLSFAFEHC
HRSSQKNKRMILIYLLPVKMLLGHMPTVELLKKYHLMQFAEVTRAVSEGNLLLLHEALAK
HEAFFIRCGIFLILEKLKIITYRNLFKKVYLLLKTHQLSLDAFLVALKFMQVEDVDIDEV
QCILANLIYMGHVKGYISHQHQKLVVSKQNPFPPLSTVC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5JVF3	1.000	1.000	7.259E-52	399	1.000	1.000	Q5JVF3.pdb.gz	PCID2_HUMAN PCI domain-containing protein 2 OS=Homo sapiens OX=9606 GN=PCID2 PE=1 SV=2
2	AFDB:Q9VTL1	0.950	0.959	3.635E-33	395	0.499	0.504	Q9VTL1.pdb.gz	PCID2_DROME PCI domain-containing protein 2 homolog OS=Drosophila melanogaster OX=7227 GN=PCID2 PE=1 SV=2
3	AFDB:Q8GWE6	0.887	0.859	9.653E-23	413	0.361	0.349	Q8GWE6.pdb.gz	EER5_ARATH Enhanced ethylene response protein 5 OS=Arabidopsis thaliana OX=3702 GN=EER5 PE=1 SV=1
4	AFDB:O13873	0.844	0.800	9.530E-22	423	0.296	0.279	O13873.pdb.gz	CSN12_SCHPO Protein CSN12 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=csn12 PE=3 SV=1
5	AFDB:Q9Y820	0.854	0.777	2.622E-17	442	0.251	0.226	Q9Y820.pdb.gz	YON7_SCHPO PCI domain-containing protein C1105.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1105.07c PE=4 SV=1
6	PDB:5g5pB	0.794	0.706	2.819E-12	455	0.208	0.182	5g5pB.pdb.gz
7	AFDB:Q38AK9	0.746	0.551	4.931E-12	556	0.213	0.153	Q38AK9.pdb.gz	Q38AK9_TRYB2 PCI domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3100 PE=4 SV=1
8	AFDB:P47130	0.736	0.698	5.351E-12	423	0.208	0.196	P47130.pdb.gz	CSN12_YEAST Cop9 signalosome complex subunit 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSN12 PE=1 SV=1
9	AFDB:Q08231	0.757	0.673	1.487E-11	455	0.198	0.174	Q08231.pdb.gz	THP1_YEAST Nuclear mRNA export protein THP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=THP1 PE=1 SV=1
10	PDB:7ewfB	0.709	0.692	1.213E-10	410	0.195	0.190	7ewfB.pdb.gz
11	AFDB:O42897	0.625	0.514	9.248E-10	497	0.150	0.121	O42897.pdb.gz	RPN3_SCHPO Probable 26S proteasome regulatory subunit rpn3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpn3 PE=3 SV=2
12	AFDB:Q9LNU4	0.620	0.518	1.779E-9	488	0.153	0.125	Q9LNU4.pdb.gz	PSD3A_ARATH 26S proteasome non-ATPase regulatory subunit 3 homolog A OS=Arabidopsis thaliana OX=3702 GN=RPN3A PE=1 SV=3
13	PDB:5gjr6	0.611	0.582	2.755E-7	421	0.165	0.157	5gjr6.pdb.gz	An atomic structure of the human 26S proteasome.
14	PDB:6j2cS	0.652	0.559	3.981E-7	475	0.110	0.093	6j2cS.pdb.gz	Structural Snapshots of 26S Proteasome Reveal Tetraubiquitin-Induced Conformations.
15	PDB:6msbV	0.556	0.450	3.075E-6	508	0.148	0.116	6msbV.pdb.gz	Cryo-EM structures and dynamics of substrate-engaged human 26S proteasome.
16	PDB:6r7fC	0.546	0.542	6.879E-5	403	0.125	0.124	6r7fC.pdb.gz
17	PDB:6r7nB	0.481	0.440	8.101E-5	443	0.135	0.122	6r7nB.pdb.gz	Structural basis of Cullin 2 RING E3 ligase regulation by the COP9 signalosome.
18	PDB:5mpbQ	0.417	0.393	1.623E-4	434	0.135	0.124	5mpbQ.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
19	PDB:3jckF	0.432	0.441	2.652E-4	388	0.130	0.134	3jckF.pdb.gz	Atomic structure of the 26S proteasome lid reveals the mechanism of deubiquitinase inhibition.
20	PDB:3txmA	0.502	0.556	2.652E-4	353	0.145	0.164	3txmA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5JVF3	0.0	828	399	1.000	1.000	PCID2_HUMAN PCI domain-containing protein 2 OS=Homo sapiens OX=9606 GN=PCID2 PE=1 SV=2
2	Q8BFV2	0.0	816	399	0.972	0.972	PCID2_MOUSE PCI domain-containing protein 2 OS=Mus musculus OX=10090 GN=Pcid2 PE=1 SV=1
3	Q9VTL1	3.78e-136	396	395	0.496	0.501	PCID2_DROME PCI domain-containing protein 2 homolog OS=Drosophila melanogaster OX=7227 GN=PCID2 PE=1 SV=2
4	Q8GWE6	8.62e-80	253	413	0.376	0.363	EER5_ARATH Enhanced ethylene response protein 5 OS=Arabidopsis thaliana OX=3702 GN=EER5 PE=1 SV=1
5	O13873	1.35e-52	182	423	0.273	0.258	CSN12_SCHPO Protein CSN12 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=csn12 PE=3 SV=1
6	Q9Y820	8.74e-33	130	442	0.216	0.195	YON7_SCHPO PCI domain-containing protein C1105.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1105.07c PE=4 SV=1
7	P47130	3.36e-17	85.1	423	0.208	0.196	CSN12_YEAST Cop9 signalosome complex subunit 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSN12 PE=1 SV=1
8	Q38AK9	4.73e-13	72.8	556	0.168	0.121	Q38AK9_TRYB2 PCI domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3100 PE=4 SV=1
9	Q08231	1.36e-11	68.2	455	0.120	0.105	THP1_YEAST Nuclear mRNA export protein THP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=THP1 PE=1 SV=1
10	Q385L2	6.84e-05	47.4	752	0.065	0.035	Q385L2_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.3260 PE=4 SV=1
11	O42897	6.66e-04	44.3	497	0.095	0.076	RPN3_SCHPO Probable 26S proteasome regulatory subunit rpn3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpn3 PE=3 SV=2
12	Q6NYV1	0.036	38.5	503	0.108	0.085	Q6NYV1_DANRE 26S proteasome non-ATPase regulatory subunit 3 OS=Danio rerio OX=7955 GN=zgc:65867 PE=1 SV=1
13	Q386U6	1.1	33.5	334	0.143	0.171	Q386U6_TRYB2 Proteasome regulatory non-ATP-ase subunit 3 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.18.0013 PE=3 SV=1
14	Q8WRU6	1.1	33.5	334	0.143	0.171	Q8WRU6_9TRYP Proteasome regulatory non-ATP-ase subunit 3 OS=Trypanosoma brucei OX=5691 GN=Rpn3 PE=2 SV=1
15	Q9VBP3	7.2	31.6	1181	0.035	0.012	TNKS_DROME Poly [ADP-ribose] polymerase tankyrase OS=Drosophila melanogaster OX=7227 GN=Tnks PE=1 SV=1
16	A0A0R4IYN3	9.8	31.2	1274	0.048	0.015	A0A0R4IYN3_DANRE Poly [ADP-ribose] polymerase OS=Danio rerio OX=7955 GN=si:ch211-155m12.3 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01399 PCI	1.2e-14	66.0	PCI domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000000753

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000003733	0.988	Minichromosome maintenance complex component 3 associated protein
2	61853.ENSNLEP00000016825	0.987	Centrin, EF-hand protein, 2
3	61853.ENSNLEP00000016661	0.982	Centrin, EF-hand protein, 3
4	61853.ENSNLEP00000005203	0.980	Transcription and mRNA export factor ENY2
5	61853.ENSNLEP00000006591	0.965	SAC3 domain containing 1
6	61853.ENSNLEP00000019407	0.965	annotation not available
7	61853.ENSNLEP00000019402	0.928	SEM1, 26S proteasome complex subunit
8	61853.ENSNLEP00000009128	0.917	RAN binding protein 2
9	61853.ENSNLEP00000010494	0.917	MAD1 mitotic arrest deficient-like 1 (yeast)
10	61853.ENSNLEP00000011078	0.917	MAD2 mitotic arrest deficient-like 1 (yeast)
11	61853.ENSNLEP00000021010	0.905	Uncharacterized protein
12	61853.ENSNLEP00000013289	0.889	COP9 signalosome subunit 5
13	61853.ENSNLEP00000021913	0.877	Translocated promoter region, nuclear basket protein
14	61853.ENSNLEP00000012765	0.850	Leukocyte receptor cluster (LRC) member 8
15	61853.ENSNLEP00000001412	0.840	Nucleoporin 153kDa
16	61853.ENSNLEP00000008375	0.789	Nuclear receptor coactivator 5
17	61853.ENSNLEP00000003864	0.723	THO complex 5
18	61853.ENSNLEP00000004827	0.701	Uncharacterized protein
19	61853.ENSNLEP00000006890	0.696	RAN binding protein 1
20	61853.ENSNLEP00000000727	0.665	THO complex 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051983	0.990	regulation of chromosome segregation
GO:0033047	0.968	regulation of mitotic sister chromatid segregation
GO:0023051	0.955	regulation of signaling
GO:0010646	0.955	regulation of cell communication
GO:0048583	0.952	regulation of response to stimulus
GO:0051783	0.931	regulation of nuclear division
GO:1901976	0.927	regulation of cell cycle checkpoint
GO:0048518	0.913	positive regulation of biological process
GO:0031323	0.901	regulation of cellular metabolic process
GO:0030071	0.898	regulation of mitotic metaphase/anaphase transition
GO:0007088	0.887	regulation of mitotic nuclear division
GO:1905818	0.882	regulation of chromosome separation
GO:0048522	0.881	positive regulation of cellular process
GO:0048519	0.875	negative regulation of biological process
GO:0019219	0.862	regulation of nucleobase-containing compound metabolic process
GO:0060255	0.854	regulation of macromolecule metabolic process
GO:0048523	0.837	negative regulation of cellular process
GO:0090068	0.837	positive regulation of cell cycle process
GO:0010965	0.825	regulation of mitotic sister chromatid separation
GO:0009987	0.658	cellular process
GO:0010468	0.508	regulation of gene expression
GO:0051252	0.406	regulation of RNA metabolic process
GO:0009892	0.393	negative regulation of metabolic process
GO:0032502	0.386	developmental process
GO:0032501	0.385	multicellular organismal process
GO:0010605	0.376	negative regulation of macromolecule metabolic process
GO:0051173	0.343	positive regulation of nitrogen compound metabolic process
GO:0031325	0.336	positive regulation of cellular metabolic process
GO:0048856	0.335	anatomical structure development
GO:0010604	0.332	positive regulation of macromolecule metabolic process
GO:0031326	0.315	regulation of cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0012505	0.994	endomembrane system
GO:0140513	0.929	nuclear protein-containing complex
GO:0031967	0.877	organelle envelope
GO:0005635	0.873	nuclear envelope
GO:0005643	0.636	nuclear pore
GO:0044615	0.522	nuclear pore nuclear basket
GO:0016020	0.309	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]