StarFunc result for job id Q5JVG8

User Input

>input (444 residues)
MGPLQFRDVAIEFSLEEWHCLDAAQRNLYRDVMLENYRNLIFLGIVVSKPNLITCLEQGK
KPLTMKRHEMIAKPPVMYSHFAQDLWSEQSIKDSFQKVILRRYEKCRHDNLQLKKGCESV
DECPVHKRGYNGLKQCLATTQRKIFQCDEYVKFLHKFSNSNKHKIRDTGKKSFKCIEYGK
TFNQSSTRTTYKKIDAGEKRYKCEECGKAYKQSSHLTTHKKIHTGEKPYKCEECGKAYKQ
SCNLTTHKIIHTGEKPYRCRECGKAFNHPATLFSHKKIHTGEKPYKCDKCGKAFISSSTL
TKHEIIHTGEKPYKCEECGKAFNRSSNLTKHKRIHTGDVPYKCDECGKTFTWYSSLSKHK
RAHTGEKPYKCEECGKAFTAFSTLTEHKIIHTGEKPYKCEECGKAFNWSSALNKHKKIHI
RQKPCIVKNVENLLNVPQPLISIR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5JVG8	1.000	1.000	1.148E-73	444	1.000	1.000	Q5JVG8.pdb.gz	ZN506_HUMAN Zinc finger protein 506 OS=Homo sapiens OX=9606 GN=ZNF506 PE=2 SV=2
2	AFDB:Q96H40	0.482	0.464	3.230E-49	463	0.736	0.706	Q96H40.pdb.gz	ZN486_HUMAN Zinc finger protein 486 OS=Homo sapiens OX=9606 GN=ZNF486 PE=2 SV=4
3	AFDB:Q14593	0.434	0.343	2.835E-46	569	0.696	0.543	Q14593.pdb.gz	ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens OX=9606 GN=ZNF273 PE=1 SV=3
4	AFDB:Q9H8G1	0.494	0.387	2.390E-45	570	0.676	0.526	Q9H8G1.pdb.gz	ZN430_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=3
5	AFDB:P35789	0.259	0.187	2.953E-44	620	0.709	0.508	P35789.pdb.gz	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
6	AFDB:Q05481	0.469	0.195	8.811E-44	1191	0.642	0.239	Q05481.pdb.gz	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
7	AFDB:Q03923	0.481	0.364	1.522E-43	595	0.691	0.516	Q03923.pdb.gz	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
8	AFDB:A6NNF4	0.441	0.278	1.607E-43	738	0.646	0.389	A6NNF4.pdb.gz	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
9	AFDB:Q03936	0.283	0.217	1.986E-42	586	0.633	0.480	Q03936.pdb.gz	ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens OX=9606 GN=ZNF92 PE=1 SV=2
10	AFDB:Q8IYN0	0.488	0.402	2.098E-42	542	0.669	0.548	Q8IYN0.pdb.gz	ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens OX=9606 GN=ZNF100 PE=1 SV=2
11	PDB:3w5kB	0.110	0.300	4.741E-4	110	0.086	0.345	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6gejS	0.064	0.107	9.979E-1	208	0.072	0.154	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
13	PDB:5dkaA	0.052	0.169	1.113	96	0.043	0.198	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
14	PDB:6n8jb	0.082	0.062	1.463	647	0.101	0.070	6n8jb.pdb.gz	Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.
15	PDB:7r5jK0	0.105	0.060	2.265	1086	0.106	0.043	7r5jK0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
16	PDB:3ps5A	0.086	0.076	2.819	529	0.052	0.043	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
17	PDB:6f40P	0.069	0.101	2.819	246	0.045	0.081	6f40P.pdb.gz	Molecular mechanism of promoter opening by RNA polymerase III.
18	PDB:7a6uA	0.085	0.110	2.819	332	0.029	0.039	7a6uA.pdb.gz
19	PDB:6vp9B	0.102	0.065	3.321	914	0.113	0.055	6vp9B.pdb.gz	Molecular basis for N-terminal alpha-synuclein acetylation by human NatB.
20	PDB:7n8oA	0.070	0.087	3.321	334	0.052	0.069	7n8oA.pdb.gz	High-resolution cryo-electron microscopy structure of photosystem II from the mesophilic cyanobacterium, Synechocystis sp. PCC 6803.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NNF4	0.0	594	616	0.667	0.481	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
2	O75437	0.0	579	659	0.673	0.454	ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens OX=9606 GN=ZNF254 PE=2 SV=3
3	P17038	0.0	559	809	0.653	0.358	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
4	P35789	0.0	623	620	0.696	0.498	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
5	Q03923	0.0	620	595	0.700	0.523	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
6	Q03936	0.0	611	586	0.698	0.529	ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens OX=9606 GN=ZNF92 PE=1 SV=2
7	Q05481	0.0	550	1191	0.646	0.241	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
8	Q14593	0.0	601	569	0.698	0.545	ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens OX=9606 GN=ZNF273 PE=1 SV=3
9	Q15928	0.0	548	474	0.610	0.572	ZN141_HUMAN Zinc finger protein 141 OS=Homo sapiens OX=9606 GN=ZNF141 PE=1 SV=1
10	Q2NKJ9	0.0	595	569	0.658	0.513	Q2NKJ9_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=1
11	Q5JVG8	0.0	917	444	1.000	1.000	ZN506_HUMAN Zinc finger protein 506 OS=Homo sapiens OX=9606 GN=ZNF506 PE=2 SV=2
12	Q8IYB9	0.0	548	648	0.631	0.432	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2
13	Q8IYN0	0.0	582	542	0.653	0.535	ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens OX=9606 GN=ZNF100 PE=1 SV=2
14	Q8IYX0	0.0	518	411	0.592	0.640	ZN679_HUMAN Zinc finger protein 679 OS=Homo sapiens OX=9606 GN=ZNF679 PE=1 SV=2
15	Q8TD23	0.0	585	568	0.662	0.518	ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens OX=9606 GN=ZNF675 PE=1 SV=3
16	Q96H40	0.0	626	463	0.712	0.683	ZN486_HUMAN Zinc finger protein 486 OS=Homo sapiens OX=9606 GN=ZNF486 PE=2 SV=4
17	Q96JC4	0.0	550	524	0.619	0.525	ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens OX=9606 GN=ZNF479 PE=1 SV=1
18	Q9H8G1	0.0	590	570	0.658	0.512	ZN430_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=3
19	Q49A12	8.64e-170	489	536	0.563	0.466	Q49A12_HUMAN ZNF85 protein OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=1
20	Q8IW36	1.66e-164	475	515	0.597	0.515	ZN695_HUMAN Zinc finger protein 695 OS=Homo sapiens OX=9606 GN=ZNF695 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05191 ADK_lid	64	14.9	Adenylate kinase, active site lid
2	PF07975 C1_4	0.033	25.7	TFIIH C1-like domain
3	PF06397 Desulfoferrod_N	2.2e+02	12.9	Desulfoferrodoxin, N-terminal domain
4	PF19553 DUF6076	97	14.1	Family of unknown function (DUF6076)
5	PF19561 DUF6083	6.7e+02	11.5	Family of unknown function (DUF6083)
6	PF07754 HVO_2753_ZBP	1.9e+02	13.3	Small zinc finger protein HVO_2753-like, Zn-binding pocket
7	PF01352 KRAB	2.1e-19	80.1	KRAB box
8	PF01286 XPA_N	2.4e-08	45.2	XPA protein N-terminal
9	PF01428 zf-AN1	10	17.7	AN1-like Zinc finger
10	PF00096 zf-C2H2	1.2e-38	140.5	Zinc finger, C2H2 type
11	PF16622 zf-C2H2_11	2.5e-11	54.4	zinc-finger C2H2-type
12	PF13894 zf-C2H2_4	1.8e-21	85.9	C2H2-type zinc finger
13	PF13912 zf-C2H2_6	9.9e-17	71.7	C2H2-type zinc finger
14	PF12171 zf-C2H2_jaz	0.05	25.1	Zinc-finger double-stranded RNA-binding
15	PF13465 zf-H2C2_2	1.8e-62	216.4	Zinc-finger double domain
16	PF02591 zf-RING_7	0.0035	28.8	C4-type zinc ribbon domain
17	PF13451 zf-trcl	0.0011	30.1	Probable zinc-ribbon domain
18	PF18439 zf_UBZ	4.8e-08	43.8	Ubiquitin-Binding Zinc Finger
19	PF17032 zinc_ribbon_15	25	17.0	zinc-ribbon family
20	PF09723 Zn-ribbon_8	6.1e-07	40.8	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000393835

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362978	0.556	Eyes absent homolog 3
2	9606.ENSP00000433378	0.510	Protocadherin alpha-6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.986	regulation of cellular process
GO:0051171	0.926	regulation of nitrogen compound metabolic process
GO:0080090	0.923	regulation of primary metabolic process
GO:0031323	0.923	regulation of cellular metabolic process
GO:0060255	0.910	regulation of macromolecule metabolic process
GO:0019219	0.906	regulation of nucleobase-containing compound metabolic process
GO:0048523	0.895	negative regulation of cellular process
GO:0009987	0.869	cellular process
GO:0031324	0.814	negative regulation of cellular metabolic process
GO:0051172	0.810	negative regulation of nitrogen compound metabolic process
GO:0045892	0.803	negative regulation of DNA-templated transcription
GO:0032501	0.533	multicellular organismal process
GO:0032502	0.523	developmental process
GO:0048856	0.462	anatomical structure development
GO:0050896	0.376	response to stimulus
GO:0008152	0.366	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.997	intracellular organelle lumen
GO:0031981	0.994	nuclear lumen
GO:0043232	0.963	intracellular non-membrane-bounded organelle
GO:0005654	0.919	nucleoplasm
GO:0005576	0.606	extracellular region
GO:0071944	0.456	cell periphery
GO:0005886	0.448	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]