StarFunc result for job id Q5JVS0

User Input

>input (413 residues)
MKGALGSPVAAAGAAMQESFGCVVANRFHQLLDDESDPFDILREAERRRQQQLQRKRRDE
AAAAAGAGPRGGRSPAGASGHRAGAGGRRESQKERKSLPAPVAQRPDSPGGGLQAPGQKR
TPRRGEQQGWNDSRGPEGMLERAERRSYREYRPYETERQADFTAEKFPDEKPGDRFDRDR
PLRGRGGPRGGMRGRGRGGPGNRVFDAFDQRGKREFERYGGNDKIAVRTEDNMGGCGVRT
WGSGKDTSDVEPTAPMEEPTVVEESQGTPEEESPAKVPELEVEEETQVQEMTLDEWKNLQ
EQTRPKPEFNIRKPESTVPSKAVVIHKSKYRDDMVKDDYEDDSHVFRKPANDITSQLEIN
FGNLPRPGRGARGGTRGGRGRIRRAENYGPRAEVVMQDVAPNPDDPEDFPALS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5JVS0	1.000	1.000	1.057E-58	413	1.000	1.000	Q5JVS0.pdb.gz	HABP4_HUMAN Intracellular hyaluronan-binding protein 4 OS=Homo sapiens OX=9606 GN=HABP4 PE=1 SV=1
2	AFDB:A1L1K8	0.180	0.181	2.310E-45	411	0.857	0.861	A1L1K8.pdb.gz	HABP4_RAT Intracellular hyaluronan-binding protein 4 OS=Rattus norvegicus OX=10116 GN=Habp4 PE=1 SV=1
3	AFDB:Q5VU21	0.132	0.138	1.675E-16	387	0.412	0.439	Q5VU21.pdb.gz	Q5VU21_HUMAN PAI-1 mRNA-binding protein variant OS=Homo sapiens OX=9606 PE=2 SV=1
4	AFDB:Q24455	0.080	0.065	1.135E-1	535	0.116	0.090	Q24455.pdb.gz	Q24455_DROME Pipsqueak protein OS=Drosophila melanogaster OX=7227 GN=psq PE=4 SV=3
5	AFDB:A0A024R162	0.087	0.076	2.143E-1	484	0.123	0.105	A0A024R162.pdb.gz
6	AFDB:Q8IL19	0.078	0.041	8.147E-1	881	0.104	0.049	Q8IL19.pdb.gz	Q8IL19_PLAF7 Protein serine/threonine kinase-1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1445400 PE=1 SV=1
7	AFDB:O01465	0.088	0.066	8.682E-1	588	0.145	0.102	O01465.pdb.gz	O01465_CAEEL Ground-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=grd-9 PE=4 SV=2
8	AFDB:M9PG92	0.089	0.056	9.252E-1	794	0.133	0.069	M9PG92.pdb.gz	M9PG92_DROME Jim, isoform G OS=Drosophila melanogaster OX=7227 GN=jim PE=4 SV=1
9	AFDB:A4Q9E8	0.102	0.062	1.120	822	0.133	0.067	A4Q9E8.pdb.gz	TTLL6_MOUSE Tubulin polyglutamylase TTLL6 OS=Mus musculus OX=10090 GN=Ttll6 PE=1 SV=1
10	AFDB:Q9Y4A8	0.092	0.063	1.120	694	0.140	0.084	Q9Y4A8.pdb.gz	NF2L3_HUMAN Nuclear factor erythroid 2-related factor 3 OS=Homo sapiens OX=9606 GN=NFE2L3 PE=1 SV=1
11	PDB:6z6mCD	0.058	0.199	2.346	55	0.046	0.345	6z6mCD.pdb.gz	Structure and function of yeast Lso2 and human CCDC124 bound to hibernating ribosomes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1L1K8	0.0	573	411	0.860	0.864	HABP4_RAT Intracellular hyaluronan-binding protein 4 OS=Rattus norvegicus OX=10116 GN=Habp4 PE=1 SV=1
2	Q5JVS0	0.0	825	413	1.000	1.000	HABP4_HUMAN Intracellular hyaluronan-binding protein 4 OS=Homo sapiens OX=9606 GN=HABP4 PE=1 SV=1
3	Q9JKS5	0.0	578	411	0.862	0.866	HABP4_MOUSE Intracellular hyaluronan-binding protein 4 OS=Mus musculus OX=10090 GN=Habp4 PE=1 SV=2
4	Q5VU21	4.84e-45	162	387	0.392	0.419	Q5VU21_HUMAN PAI-1 mRNA-binding protein variant OS=Homo sapiens OX=9606 PE=2 SV=1
5	Q6AXS5	2.86e-43	158	407	0.404	0.410	SERB1_RAT SERPINE1 mRNA-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Serbp1 PE=1 SV=2
6	Q8NC51	3.75e-42	155	408	0.395	0.400	SERB1_HUMAN SERPINE1 mRNA-binding protein 1 OS=Homo sapiens OX=9606 GN=SERBP1 PE=1 SV=2
7	Q6R6M4	6.59e-13	72.4	530	0.136	0.106	U17L2_HUMAN Ubiquitin carboxyl-terminal hydrolase 17 OS=Homo sapiens OX=9606 GN=USP17L2 PE=1 SV=2
8	Q9V426	2.08e-12	70.9	490	0.121	0.102	Q9V426_DROME LD07162p OS=Drosophila melanogaster OX=7227 GN=vig PE=1 SV=1
9	Q960D3	2.22e-12	70.5	412	0.174	0.175	Q960D3_DROME SD06613p OS=Drosophila melanogaster OX=7227 GN=vig2 PE=1 SV=1
10	Q9VBX3	4.57e-12	69.7	443	0.172	0.160	Q9VBX3_DROME Vig2, isoform B OS=Drosophila melanogaster OX=7227 GN=vig2 PE=1 SV=2
11	Q0WX57	6.76e-12	69.3	530	0.136	0.106	U17LO_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 24 OS=Homo sapiens OX=9606 GN=USP17L24 PE=1 SV=2
12	O23593	1.47e-05	49.3	360	0.145	0.167	RGGB_ARATH RGG repeats nuclear RNA binding protein B OS=Arabidopsis thaliana OX=3702 GN=RGGB PE=1 SV=1
13	Q9VXX1	0.074	37.4	309	0.080	0.107	Q9VXX1_DROME AT19571p OS=Drosophila melanogaster OX=7227 GN=PPYR1 PE=2 SV=2
14	P46151	0.63	34.7	657	0.041	0.026	MTHR1_YEAST Methylenetetrahydrofolate reductase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MET12 PE=1 SV=2
15	Q84TD8	5.0	31.6	359	0.087	0.100	FLXL2_ARATH Protein FLX-like 2 OS=Arabidopsis thaliana OX=3702 GN=FLXL2 PE=1 SV=1
16	H2KYR1	7.2	31.2	378	0.109	0.119	H2KYR1_CAEEL Hyaluronan/mRNA-binding protein domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=vig-1 PE=1 SV=1
17	A0A0A0MTC1	8.6	31.2	5256	0.128	0.010	A0A0A0MTC1_HUMAN Ring finger protein 213 OS=Homo sapiens OX=9606 GN=RNF213 PE=1 SV=1
18	A0A0A0MTR7	8.6	31.2	5207	0.128	0.010	A0A0A0MTR7_HUMAN Ring finger protein 213 OS=Homo sapiens OX=9606 GN=RNF213 PE=1 SV=1
19	Q63HN8	8.7	31.2	5207	0.128	0.010	RN213_HUMAN E3 ubiquitin-protein ligase RNF213 OS=Homo sapiens OX=9606 GN=RNF213 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04774 HABP4_PAI-RBP1	1.7e-17	75.6	Hyaluronan / mRNA binding family
2	PF16174 IHABP4_N	1.3e-64	228.7	Intracellular hyaluronan-binding protein 4 N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364398

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000426909	0.990	Receptor of activated protein C kinase 1
2	9606.ENSP00000432799	0.913	Mesencephalic astrocyte-derived neurotrophic factor
3	9606.ENSP00000316029	0.906	Talin-1
4	9606.ENSP00000427687	0.906	WD repeat-containing protein 1
5	9606.ENSP00000358866	0.904	Filamin-A
6	9606.ENSP00000467141	0.903	Titin
7	9606.ENSP00000211998	0.902	Vinculin
8	9606.ENSP00000248437	0.902	Tubulin alpha-4A chain
9	9606.ENSP00000278505	0.902	Endonuclease domain-containing 1 protein
10	9606.ENSP00000296511	0.902	Annexin A5
11	9606.ENSP00000350267	0.901	Bromodomain and PHD finger-containing protein 3
12	9606.ENSP00000234313	0.900	Pleckstrin
13	9606.ENSP00000270142	0.900	Superoxide dismutase [Cu-Zn]
14	9606.ENSP00000357076	0.900	Transgelin-2
15	9606.ENSP00000413606	0.900	Syntaxin-binding protein 2
16	9606.ENSP00000361626	0.889	Nuclease-sensitive element-binding protein 1
17	9606.ENSP00000269305	0.867	Cellular tumor antigen p53
18	9606.ENSP00000258774	0.785	Checkpoint protein HUS1
19	9606.ENSP00000309830	0.763	Ribosomal protein L38
20	9606.ENSP00000369716	0.742	Chromodomain-helicase-DNA-binding protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0032183	0.997	SUMO binding
GO:0003676	0.629	nucleic acid binding
GO:0003723	0.489	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050789	0.982	regulation of biological process
GO:0050794	0.974	regulation of cellular process
GO:0019222	0.946	regulation of metabolic process
GO:0051171	0.940	regulation of nitrogen compound metabolic process
GO:0010468	0.937	regulation of gene expression
GO:0031323	0.935	regulation of cellular metabolic process
GO:0080090	0.934	regulation of primary metabolic process
GO:0009889	0.927	regulation of biosynthetic process
GO:0010556	0.924	regulation of macromolecule biosynthetic process
GO:0031326	0.910	regulation of cellular biosynthetic process
GO:0048518	0.888	positive regulation of biological process
GO:0071840	0.886	cellular component organization or biogenesis
GO:0048522	0.820	positive regulation of cellular process
GO:0009893	0.790	positive regulation of metabolic process
GO:0016043	0.769	cellular component organization
GO:0010604	0.762	positive regulation of macromolecule metabolic process
GO:0019219	0.759	regulation of nucleobase-containing compound metabolic process
GO:0051246	0.743	regulation of protein metabolic process
GO:0034248	0.642	regulation of amide metabolic process
GO:2000112	0.607	regulation of cellular macromolecule biosynthetic process
GO:0051252	0.521	regulation of RNA metabolic process
GO:0010608	0.507	post-transcriptional regulation of gene expression
GO:0051173	0.494	positive regulation of nitrogen compound metabolic process
GO:0031325	0.494	positive regulation of cellular metabolic process
GO:0008152	0.412	metabolic process
GO:0010628	0.375	positive regulation of gene expression
GO:0006417	0.370	regulation of translation
GO:0065009	0.364	regulation of molecular function
GO:0050896	0.363	response to stimulus
GO:0044237	0.352	cellular metabolic process
GO:0045935	0.332	positive regulation of nucleobase-containing compound metabolic process
GO:0071704	0.317	organic substance metabolic process
GO:0043484	0.311	regulation of RNA splicing

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043232	0.997	intracellular non-membrane-bounded organelle
GO:0031981	0.995	nuclear lumen
GO:0016020	0.991	membrane
GO:0005829	0.982	cytosol
GO:0005654	0.981	nucleoplasm
GO:0032991	0.946	protein-containing complex
GO:0012505	0.924	endomembrane system
GO:0030054	0.896	cell junction
GO:1990904	0.852	ribonucleoprotein complex
GO:0031090	0.719	organelle membrane
GO:0005576	0.711	extracellular region
GO:0099080	0.705	supramolecular complex
GO:0005730	0.647	nucleolus
GO:0031975	0.634	envelope
GO:0016604	0.622	nuclear body
GO:0031967	0.602	organelle envelope
GO:0035770	0.473	ribonucleoprotein granule
GO:0036464	0.452	cytoplasmic ribonucleoprotein granule
GO:0016607	0.398	nuclear speck
GO:0010494	0.386	cytoplasmic stress granule
GO:0097504	0.367	Gemini of coiled bodies
GO:0005635	0.347	nuclear envelope
GO:0005615	0.316	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]