StarFunc result for job id Q5JWF2

User Input

>input (1037 residues)
MGVRNCLYGNNMSGQRDIPPEIGEQPEQPPLEAPGAAAPGAGPSPAEEMETEPPHNEPIP
VENDGEACGPPEVSRPNFQVLNPAFREAGAHGSYSPPPEEAMPFEAEQPSLGGFWPTLEQ
PGFPSGVHAGLEAFGPALMEPGAFSGARPGLGGYSPPPEEAMPFEFDQPAQRGCSQLLLQ
VPDLAPGGPGAAGVPGAPPEEPQALRPAKAGSRGGYSPPPEETMPFELDGEGFGDDSPPP
GLSRVIAQVDGSSQFAAVAASSAVRLTPAANAPPLWVPGAIGSPSQEAVRPPSNFTGSSP
WMEISGPPFEIGSAPAGVDDTPVNMDSPPIALDGPPIKVSGAPDKRERAERPPVEEEAAE
MEGAADAAEGGKVPSPGYGSPAAGAASADTAARAAPAAPADPDSGATPEDPDSGTAPADP
DSGAFAADPDSGAAPAAPADPDSGAAPDAPADPDSGAAPDAPADPDAGAAPEAPAAPAAA
ETRAAHVAPAAPDAGAPTAPAASATRAAQVRRAASAAPASGARRKIHLRPPSPEIQAADP
PTPRPTRASAWRGKSESSRGRRVYYDEGVASSDDDSSGDESDDGTSGCLRWFQHRRNRRR
RKPQRNLLRNFLVQAFGGCFGRSESPQPKASRSLKVKKVPLAEKRRQMRKEALEKRAQKR
AEKKRSKLIDKQLQDEKMGYMCTHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDP
QAARSNSDGEKATKVQDIKNNLKEAIETIVAAMSNLVPPVELANPENQFRVDYILSVMNV
PDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQADYVPSDQDL
LRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVI
REDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFAR
YTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCYPHFTCAVDTENIRRVFN
DCRDIIQRMHLRQYELL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5JWF2	1.000	1.000	0.000	1037	1.000	1.000	Q5JWF2.pdb.gz	GNAS1_HUMAN Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas OS=Homo sapiens OX=9606 GN=GNAS PE=1 SV=2
2	AFDB:Q6R0H7	0.441	0.405	7.771E-97	1133	0.735	0.673	Q6R0H7.pdb.gz	GNAS1_MOUSE Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas OS=Mus musculus OX=10090 GN=Gnas PE=1 SV=1
3	AFDB:Q63803	0.462	0.423	1.066E-94	1144	0.725	0.657	Q63803.pdb.gz	GNAS1_RAT Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas OS=Rattus norvegicus OX=10116 GN=Gnas PE=1 SV=3
4	PDB:6eg8I	0.352	0.969	5.702E-56	372	0.337	0.938	6eg8I.pdb.gz	Structural Insights into the Process of GPCR-G Protein Complex Formation.
5	PDB:7ki1A	0.260	0.683	3.504E-44	349	0.309	0.917	7ki1A.pdb.gz
6	PDB:7jozA	0.222	0.621	1.273E-36	338	0.300	0.920	7jozA.pdb.gz	Crystal structure of dopamine D1 receptor in complex with G protein and a non-catechol agonist.
7	PDB:1gotA	0.310	0.928	9.990E-32	338	0.139	0.426	1gotA.pdb.gz	The 2.0 A crystal structure of a heterotrimeric G protein.
8	PDB:1tndA	0.290	0.914	1.523E-29	323	0.131	0.421	1tndA.pdb.gz	The 2.2 A crystal structure of transducin-alpha complexed with GTP gamma S.
9	PDB:3ah8A	0.301	0.870	7.064E-29	342	0.137	0.415	3ah8A.pdb.gz	Structural basis for the specific inhibition of heterotrimeric Gq protein by a small molecule.
10	PDB:7lciA	0.223	0.889	9.187E-27	244	0.207	0.881	7lciA.pdb.gz	Evolving cryo-EM structural approaches for GPCR drug discovery.
11	PDB:3c7kC	0.286	0.933	2.511E-26	311	0.137	0.457	3c7kC.pdb.gz	Molecular architecture of G{alpha}o and the structural basis for RGS16-mediated deactivation.
12	PDB:1zcbA	0.270	0.843	5.854E-26	318	0.129	0.421	1zcbA.pdb.gz	A new approach to producing functional G alpha subunits yields the activated and deactivated structures of G alpha(12/13) proteins.
13	PDB:2xtzA	0.296	0.864	2.716E-25	343	0.100	0.303	2xtzA.pdb.gz	The Crystal Structure of a Self-Activating G Protein Alpha Subunit Reveals its Distinct Mechanism of Signal Initiation
14	AFDB:O81283	0.100	0.072	1.315E-3	1503	0.137	0.094	O81283.pdb.gz	TC159_ARATH Translocase of chloroplast 159, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TOC159 PE=1 SV=1
15	AFDB:Q9SLF3	0.098	0.086	2.758E-3	1206	0.118	0.101	Q9SLF3.pdb.gz	TC132_ARATH Translocase of chloroplast 132, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TOC132 PE=1 SV=1
16	AFDB:Q9Z213	0.039	0.047	1.710E-1	738	0.139	0.195	Q9Z213.pdb.gz	ALEX_RAT Protein ALEX OS=Rattus norvegicus OX=10116 GN=Gnas PE=1 SV=1
17	AFDB:A1ZBJ6	0.123	0.097	3.987E-1	1379	0.148	0.111	A1ZBJ6.pdb.gz	A1ZBJ6_DROME Rad, Gem/Kir family member 1, isoform B OS=Drosophila melanogaster OX=7227 GN=Rgk1 PE=4 SV=2
18	AFDB:Q9UJ55	0.038	0.033	5.775E-1	1249	0.123	0.102	Q9UJ55.pdb.gz	MAGL2_HUMAN MAGE-like protein 2 OS=Homo sapiens OX=9606 GN=MAGEL2 PE=1 SV=2
19	AFDB:Q80XI3	0.069	0.053	9.803E-1	1579	0.164	0.108	Q80XI3.pdb.gz	IF4G3_MOUSE Eukaryotic translation initiation factor 4 gamma 3 OS=Mus musculus OX=10090 GN=Eif4g3 PE=1 SV=2
20	AFDB:X2JEM2	0.038	0.021	1.277	2326	0.130	0.058	X2JEM2.pdb.gz	X2JEM2_DROME Secretory 16, isoform I OS=Drosophila melanogaster OX=7227 GN=Sec16 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G5EF72	0.0	538	375	0.240	0.664	G5EF72_CAEEL G protein a(S) subunit OS=Caenorhabditis elegans OX=6239 PE=2 SV=1
2	P20354	0.0	562	385	0.259	0.699	GNAS_DROME G protein alpha s subunit OS=Drosophila melanogaster OX=7227 GN=Galphas PE=2 SV=1
3	P38405	0.0	627	381	0.277	0.753	GNAL_HUMAN Guanine nucleotide-binding protein G(olf) subunit alpha OS=Homo sapiens OX=9606 GN=GNAL PE=1 SV=1
4	P38406	0.0	624	381	0.276	0.751	GNAL_RAT Guanine nucleotide-binding protein G(olf) subunit alpha OS=Rattus norvegicus OX=10116 GN=Gnal PE=2 SV=2
5	P63092	0.0	784	394	0.352	0.926	GNAS2_HUMAN Guanine nucleotide-binding protein G(s) subunit alpha isoforms short OS=Homo sapiens OX=9606 GN=GNAS PE=1 SV=1
6	P63094	0.0	783	394	0.351	0.924	GNAS2_MOUSE Guanine nucleotide-binding protein G(s) subunit alpha isoforms short OS=Mus musculus OX=10090 GN=Gnas PE=1 SV=1
7	P63095	0.0	783	394	0.351	0.924	GNAS2_RAT Guanine nucleotide-binding protein G(s) subunit alpha isoforms short OS=Rattus norvegicus OX=10116 GN=Gnas PE=1 SV=1
8	Q5JWF2	0.0	2094	1037	1.000	1.000	GNAS1_HUMAN Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas OS=Homo sapiens OX=9606 GN=GNAS PE=1 SV=2
9	Q63803	0.0	878	1144	0.430	0.390	GNAS1_RAT Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas OS=Rattus norvegicus OX=10116 GN=Gnas PE=1 SV=3
10	Q6R0H7	0.0	1273	1133	0.728	0.666	GNAS1_MOUSE Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas OS=Mus musculus OX=10090 GN=Gnas PE=1 SV=1
11	Q6X973	0.0	714	340	0.323	0.985	Q6X973_RABIT Guanine nucleotide-binding protein Gs alpha1 (Fragment) OS=Oryctolagus cuniculus OX=9986 PE=2 SV=1
12	Q7KPV0	0.0	538	378	0.240	0.659	Q7KPV0_CAEEL Guanine nucleotide-binding protein G(S) subunit alpha OS=Caenorhabditis elegans OX=6239 GN=gsa-1 PE=1 SV=1
13	Q8CGK7	0.0	627	381	0.277	0.753	GNAL_MOUSE Guanine nucleotide-binding protein G(olf) subunit alpha OS=Mus musculus OX=10090 GN=Gnal PE=1 SV=1
14	W5U7I9	0.0	636	379	0.279	0.763	W5U7I9_ICTPU Guanine nucleotide-binding protein G(Olf) subunit alpha OS=Ictalurus punctatus OX=7998 GN=Gnal PE=2 SV=1
15	V6CL61	1.45e-153	458	285	0.196	0.712	V6CL61_CAEEL Guanine nucleotide-binding protein G(S) subunit alpha OS=Caenorhabditis elegans OX=6239 GN=gsa-1 PE=1 SV=1
16	P29348	6.22e-84	277	354	0.150	0.441	GNAT3_RAT Guanine nucleotide-binding protein G(t) subunit alpha-3 OS=Rattus norvegicus OX=10116 GN=Gnat3 PE=1 SV=3
17	Q3V3I2	2.63e-82	273	354	0.149	0.435	GNAT3_MOUSE Guanine nucleotide-binding protein G(t) subunit alpha-3 OS=Mus musculus OX=10090 GN=Gnat3 PE=1 SV=2
18	P0C7Q4	2.58e-81	270	354	0.149	0.438	GNAT3_BOVIN Guanine nucleotide-binding protein G(t) subunit alpha-3 OS=Bos taurus OX=9913 GN=GNAT3 PE=1 SV=1
19	P51875	2.92e-81	270	354	0.150	0.441	GNAO_CAEEL Guanine nucleotide-binding protein G(o) subunit alpha OS=Caenorhabditis elegans OX=6239 GN=goa-1 PE=1 SV=3
20	A8MTJ3	7.52e-81	269	354	0.149	0.438	GNAT3_HUMAN Guanine nucleotide-binding protein G(t) subunit alpha-3 OS=Homo sapiens OX=9606 GN=GNAT3 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13555 AAA_29	7.4e+02	11.3	P-loop containing region of AAA domain
2	PF00025 Arf	2.1e-11	55.1	ADP-ribosylation factor family
3	PF00503 G-alpha	4.5e-99	343.6	G-protein alpha subunit
4	PF04670 Gtr1_RagA	7.2	17.5	Gtr1/RagA G protein conserved region
5	PF08477 Roc	26	16.5	Ras of Complex, Roc, domain of DAPkinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360141

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000481878	0.999	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
2	9606.ENSP00000334448	0.998	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2
3	9606.ENSP00000294016	0.997	Adenylate cyclase type 9
4	9606.ENSP00000305372	0.994	Beta-2 adrenergic receptor
5	9606.ENSP00000419361	0.991	Adenylate cyclase type 5
6	9606.ENSP00000362353	0.988	Glucagon-like peptide 1 receptor
7	9606.ENSP00000383558	0.987	Glucagon receptor
8	9606.ENSP00000342952	0.985	Adenylate cyclase type 2
9	9606.ENSP00000291294	0.981	Prostacyclin receptor
10	9606.ENSP00000376475	0.981	cAMP-dependent protein kinase type I-alpha regulatory subunit
11	9606.ENSP00000462647	0.980	Pituitary adenylate cyclase-activating polypeptide
12	9606.ENSP00000311405	0.978	Adenylate cyclase type 6
13	9606.ENSP00000381333	0.976	Corticotropin-releasing factor receptor 1
14	9606.ENSP00000386972	0.973	Calcitonin gene-related peptide type 1 receptor
15	9606.ENSP00000297323	0.972	Adenylate cyclase type 1
16	9606.ENSP00000377353	0.971	D(1A) dopamine receptor
17	9606.ENSP00000409581	0.968	Beta-arrestin-1
18	9606.ENSP00000019103	0.967	Secretin receptor
19	9606.ENSP00000334051	0.967	Guanine nucleotide-binding protein G(olf) subunit alpha
20	9606.ENSP00000351805	0.965	Vasopressin V2 receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003824	0.986	catalytic activity
GO:0017111	0.968	ribonucleoside triphosphate phosphatase activity
GO:0003924	0.959	GTPase activity
GO:0098772	0.730	molecular function regulator activity
GO:0097159	0.557	organic cyclic compound binding
GO:1901363	0.418	heterocyclic compound binding
GO:0140677	0.321	molecular function activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.997	response to stimulus
GO:0009987	0.997	cellular process
GO:0050789	0.997	regulation of biological process
GO:0023052	0.994	signaling
GO:0007154	0.994	cell communication
GO:0050794	0.991	regulation of cellular process
GO:0007165	0.979	signal transduction
GO:0007186	0.967	G protein-coupled receptor signaling pathway
GO:0032501	0.953	multicellular organismal process
GO:0032502	0.889	developmental process
GO:0048856	0.838	anatomical structure development
GO:0007188	0.836	adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0065008	0.812	regulation of biological quality
GO:0007189	0.777	adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007275	0.767	multicellular organism development
GO:0050878	0.731	regulation of body fluid levels
GO:0050817	0.719	coagulation
GO:0007599	0.719	hemostasis
GO:0042060	0.712	wound healing
GO:0048731	0.659	system development
GO:0034109	0.638	homotypic cell-cell adhesion
GO:0007596	0.607	blood coagulation
GO:0040007	0.571	growth
GO:0048513	0.523	animal organ development
GO:0030168	0.521	platelet activation
GO:0060348	0.510	bone development
GO:0048518	0.445	positive regulation of biological process
GO:0019222	0.411	regulation of metabolic process
GO:0060255	0.390	regulation of macromolecule metabolic process
GO:0048522	0.368	positive regulation of cellular process
GO:0010646	0.325	regulation of cell communication
GO:0023051	0.323	regulation of signaling
GO:0048519	0.319	negative regulation of biological process
GO:0042221	0.310	response to chemical
GO:0070527	0.304	platelet aggregation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0043227	0.999	membrane-bounded organelle
GO:0005737	0.998	cytoplasm
GO:0005576	0.987	extracellular region
GO:0005829	0.987	cytosol
GO:0031982	0.976	vesicle
GO:0005615	0.969	extracellular space
GO:0005886	0.963	plasma membrane
GO:0070062	0.885	extracellular exosome
GO:0032991	0.853	protein-containing complex
GO:0043231	0.610	intracellular membrane-bounded organelle
GO:1902494	0.459	catalytic complex
GO:0098796	0.438	membrane protein complex
GO:0012505	0.341	endomembrane system
GO:0098797	0.337	plasma membrane protein complex
GO:0009898	0.301	cytoplasmic side of plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:23680	0.968	a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate
EC:3.6.1.15	0.968	nucleoside-triphosphate phosphatase.
RHEA:19669	0.959	GTP + H2O = GDP + H(+) + phosphate

[back to server]