StarFunc result for job id Q5JWR5

User Input

>input (2465 residues)
MNTEELELLSDSKYRNYVAAIDKALKNFEYSSEWADLISALGKLNKVLQNNAKYQVVPKK
LTIGKRLAQCLHPALPGGVHRKALETYEIIFKIIGPKRLAKDLFLYSSGLFPLLANAAMS
VKPTLLSLYEIYYLPLGKTLKPGLQGLLTGILPGLEEGSEYYERTNMLLEKVAAAVDQSA
FYSALWGSLLTSPAVRLPGITYVLAHLNRKLSMEDQLYIIGSDIELMVEAVSTSVQDSSV
LVQRSTLDLILFCFPFHMSQATRPDMIRILSAALHVVLRRDMSLNRRLYAWLLGFDNNGA
IIGPRSTRHSNPEEHATYYFTTFSKELLVQAMVGILQVNGFGEENTLMQDLKPFRILISL
LDKPELGPVILEDVLIEVFRTLYSQCKAELDLQTEPPFSKDHAQLSSKLRENKKTAELIK
TANLLFNSFEPYYMWDYVARWFEECCRRTLHVRLQIGPGDSNDSSELQLTNFCLLVDFLL
DIVSLPTRSMRVLCQETYIEIQTEHLPQLLLRMISALTSHLQTLHLSELTDSLRLCSKIL
SKVQPPLLSASTGGVLQFPSGQNNSVKEWEDKKVSSVSHENPTEVFEDGENPPSSRSSES
GFTEFIQYQADRTDDIDRELSEGQGAAAIPIGSTSSETETASTVGSEETIIQTPSVVTQG
TATRSRKTAQKTAMQCCLEYVQQFLTRLINLYIIQNNSFSQSLATEHQGDLGREQGETSK
WDRNSQGDVKEKNISKQKTSKEYLSAFLAACQLFLECSSFPVYIAEGNHTSELRSEKLET
DCEHVQPPQWLQTLMNACSQASDFSVQSVAISLVMDLVGLTQSVAMVTGENINSVEPAQP
LSPNQGRVAVVIRPPLTQGNLRYIAEKTEFFKHVALTLWDQLGDGTPQHHQKSVELFYQL
HNLVPSSSICEDVISQQLTHKDKKIRMEAHAKFAVLWHLTRDLHINKSSSFVRSFDRSLF
IMLDSLNSLDGSTSSVGQAWLNQVLQRHDIARVLEPLLLLLLHPKTQRVSVQRVQAERYW
NKSPCYPGEESDKHFMQNFACSNVSQVQLITSKGNGEKPLTMDEIENFSLTVNPLSDRLS
LLSTSSETIPMVVSDFDLPDQQIEILQSSDSGCSQSSAGDNLSYEVDPETVNAQEDSQMP
KESSPDDDVQQVVFDLICKVVSGLEVESASVTSQLEIEAMPPKCSDIDPDEETIKIEDDS
IQQSQNALLSNESSQFLSVSAEGGHECVANGISRNSSSPCISGTTHTLHDSSVASIETKS
RQRSHSSIQFSFKEKLSEKVSEKETIVKESGKQPGAKPKVKLARKKDDDKKKSSNEKLKQ
TSVFFSDGLDLENWYSCGEGDISEIESDMGSPGSRKSPNFNIHPLYQHVLLYLQLYDSSR
TLYAFSAIKAILKTNPIAFVNAISTTSVNNAYTPQLSLLQNLLARHRISVMGKDFYSHIP
VDSNHNFRSSMYIEILISLCLYYMRSHYPTHVKVTAQDLIGNRNMQMMSIEILTLLFTEL
AKVIESSAKGFPSFISDMLSKCKVQKVILHCLLSSIFSAQKWHSEKMAGKNLVAVEEGFS
EDSLINFSEDEFDNGSTLQSQLLKVLQRLIVLEHRVMTIPEENETGFDFVVSDLEHISPH
QPMTSLQYLHAQPITCQGMFLCAVIRALHQHCACKMHPQWIGLITSTLPYMGKVLQRVVV
SVTLQLCRNLDNLIQQYKYETGLSDSRPLWMASIIPPDMILTLLEGITAIIHYCLLDPTT
QYHQLLVSVDQKHLFEARSGILSILHMIMSSVTLLWSILHQADSSEKMTIAASASLTTIN
LGATKNLRQQILELLGPISMNHGVHFMAAIAFVWNERRQNKTTTRTKVIPAASEEQLLLV
ELVRSISVMRAETVIQTVKEVLKQPPAIAKDKKHLSLEVCMLQFFYAYIQRIPVPNLVDS
WASLLILLKDSIQLSLPAPGQFLILGVLNEFIMKNPSLENKKDQRDLQDVTHKIVDAIGA
IAGSSLEQTTWLRRNLEVKPSPKIMVDGTNLESDVEDMLSPAMETANITPSVYSVHALTL
LSEVLAHLLDMVFYSDEKERVIPLLVNIMHYVVPYLRNHSAHNAPSYRACVQLLSSLSGY
QYTRRAWKKEAFDLFMDPSFFQMDASCVNHWRAIMDNLMTHDKTTFRDLMTRVAVAQSSS
LNLFANRDVELEQRAMLLKRLAFAIFSSEIDQYQKYLPDIQERLVESLRLPQVPTLHSQV
FLFFRVLLLRMSPQHLTSLWPTMITELVQVFLLMEQELTADEDISRTSGPSVAGLETTYT
GGNGFSTSYNSQRWLNLYLSACKFLDLALALPSENLPQFQMYRWAFIPEASDDSGLEVRR
QGIHQREFKPYVVRLAKLLRKRAKKNPEEDNSGRTLGWEPGHLLLTICTVRSMEQLLPFF
NVLSQVFNSKVTSRCGGHSGSPILYSNAFPNKDMKLENHKPCSSKARQKIEEMVEKDFLE
GMIKT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4A0Y2	0.376	0.378	0.000	2452	0.928	0.933	D4A0Y2.pdb.gz	D4A0Y2_RAT DOP1 leucine zipper like protein A OS=Rattus norvegicus OX=10116 GN=Dop1a PE=1 SV=3
2	AFDB:Q9Y3R5	0.353	0.376	0.000	2298	0.380	0.408	Q9Y3R5.pdb.gz	DOP2_HUMAN Protein dopey-2 OS=Homo sapiens OX=9606 GN=DOP1B PE=1 SV=5
3	AFDB:Q9C0Z4	0.217	0.301	3.422E-35	1687	0.136	0.199	Q9C0Z4.pdb.gz	DOP1_SCHPO Protein dopey OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAPB21F2.02 PE=1 SV=1
4	PDB:7mqaSP	0.084	0.084	4.745E-8	2485	0.116	0.115	7mqaSP.pdb.gz	Nucleolar maturation of the human small subunit processome.
5	PDB:7mqaLM	0.100	0.113	4.092E-7	2041	0.103	0.124	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
6	PDB:7ajuUT	0.111	0.115	6.631E-7	2313	0.110	0.117	7ajuUT.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
7	PDB:7mq8LM	0.094	0.108	2.097E-6	2005	0.111	0.136	7mq8LM.pdb.gz	Nucleolar maturation of the human small subunit processome.
8	PDB:7sglA	0.122	0.094	1.075E-5	3852	0.118	0.076	7sglA.pdb.gz	Autophosphorylation transforms DNA-PK from protecting to processing DNA ends.
9	PDB:6ahoA	0.106	0.208	1.202E-5	916	0.052	0.139	6ahoA.pdb.gz
10	AFDB:O42874	0.070	0.094	1.586E-5	1462	0.090	0.152	O42874.pdb.gz	STU1_SCHPO Protein peg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=peg1 PE=1 SV=1
11	PDB:7w7gB	0.157	0.209	1.948E-5	1711	0.088	0.127	7w7gB.pdb.gz	Structure and mechanism of NALCN-FAM155A-UNC79-UNC80 channel complex.
12	PDB:7k1nA	0.082	0.062	2.022E-5	3634	0.121	0.082	7k1nA.pdb.gz	Structure of an activated DNA-PK and its implications for NHEJ.
13	PDB:3nd2A	0.079	0.152	2.098E-5	861	0.038	0.109	3nd2A.pdb.gz
14	PDB:3w3uA	0.079	0.144	2.346E-5	1030	0.039	0.094	3w3uA.pdb.gz
15	AFDB:Q9P2D8	0.118	0.114	4.167E-4	2635	0.101	0.094	Q9P2D8.pdb.gz	UNC79_HUMAN Protein unc-79 homolog OS=Homo sapiens OX=9606 GN=UNC79 PE=1 SV=4
16	AFDB:P27715	0.072	0.078	7.275E-4	2155	0.091	0.104	P27715.pdb.gz	UNC13_CAEEL Phorbol ester/diacylglycerol-binding protein unc-13 OS=Caenorhabditis elegans OX=6239 GN=unc-13 PE=1 SV=4
17	AFDB:Q0KK59	0.080	0.077	7.550E-4	2596	0.100	0.095	Q0KK59.pdb.gz	UNC79_MOUSE Protein unc-79 homolog OS=Mus musculus OX=10090 GN=Unc79 PE=1 SV=1
18	AFDB:Q7Z333	0.065	0.062	3.336E-3	2677	0.083	0.076	Q7Z333.pdb.gz	SETX_HUMAN Probable helicase senataxin OS=Homo sapiens OX=9606 GN=SETX PE=1 SV=4
19	AFDB:Q93971	0.056	0.064	9.094E-3	2032	0.073	0.089	Q93971.pdb.gz	TRPG_CAEEL Transient receptor potential channel OS=Caenorhabditis elegans OX=6239 GN=gon-2 PE=1 SV=4
20	AFDB:Q9W517	0.068	0.086	1.318E-2	1741	0.069	0.098	Q9W517.pdb.gz	WAPL_DROME Protein wings apart-like OS=Drosophila melanogaster OX=7227 GN=wapl PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A0N6	0.0	4691	2453	0.929	0.933	A0A8I6A0N6_RAT DOP1 leucine zipper like protein A OS=Rattus norvegicus OX=10116 GN=Dop1a PE=3 SV=1
2	D4A0Y2	0.0	4659	2443	0.925	0.933	D4A0Y2_RAT DOP1 leucine zipper like protein A OS=Rattus norvegicus OX=10116 GN=Dop1a PE=1 SV=3
3	Q9Y3R5	0.0	735	2298	0.175	0.188	DOP2_HUMAN Protein dopey-2 OS=Homo sapiens OX=9606 GN=DOP1B PE=1 SV=5
4	Q9Y7B3	4.26e-51	202	1858	0.060	0.080	DOP1_EMENI Protein dopey OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=dop1 PE=1 SV=1
5	Q9C0Z4	1.94e-49	197	1687	0.049	0.071	DOP1_SCHPO Protein dopey OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAPB21F2.02 PE=1 SV=1
6	Q03921	3.92e-34	147	1698	0.055	0.080	DOP1_YEAST Protein dopey OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DOP1 PE=1 SV=1
7	O13834	1.0	37.4	3227	0.016	0.012	PTR1_SCHPO E3 ubiquitin-protein ligase ptr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ptr1 PE=1 SV=1
8	Q9MBH2	3.8	33.9	169	0.011	0.166	AIG2B_ARATH Protein AIG2 B OS=Arabidopsis thaliana OX=3702 GN=AIG2B PE=2 SV=1
9	Q9LZX8	6.3	34.7	1793	0.014	0.020	BIG2_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Arabidopsis thaliana OX=3702 GN=BIG2 PE=2 SV=1
10	Q589Y0	6.5	34.3	453	0.009	0.046	MAT1_TOBAC Phenolic glucoside malonyltransferase 1 OS=Nicotiana tabacum OX=4097 GN=mat1 PE=1 SV=1
11	P49686	6.7	34.3	430	0.012	0.067	NUP42_YEAST Nucleoporin NUP42 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NUP42 PE=1 SV=1
12	Q382M2	6.9	32.3	116	0.011	0.224	Q382M2_TRYB2 Cytochrome c oxidase subunit 10, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.4702 PE=4 SV=1
13	P25822	8.4	34.3	1533	0.008	0.012	PUM_DROME Maternal protein pumilio OS=Drosophila melanogaster OX=7227 GN=pum PE=1 SV=2
14	Q948U0	8.4	34.3	963	0.014	0.036	RBOHA_SOLTU Respiratory burst oxidase homolog protein A OS=Solanum tuberosum OX=4113 GN=RBOHA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04118 Dopey_N	3.1e-99	343.6	Dopey, N-terminal
2	PF02233 PNTB	1.2e+02	13.0	NAD(P) transhydrogenase beta subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000023309

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000026540	0.946	MON2 homolog, regulator of endosome-to-Golgi trafficking
2	9593.ENSGGOP00000011609	0.813	Pseudouridylate synthase 7 (putative)
3	9593.ENSGGOP00000005484	0.763	Uncharacterized protein
4	9593.ENSGGOP00000015857	0.660	Zinc finger with KRAB and SCAN domains 8
5	9593.ENSGGOP00000000680	0.653	Forkhead-associated (FHA) phosphopeptide binding domain 1
6	9593.ENSGGOP00000007515	0.578	Sodium channel, voltage-gated, type III, beta subunit
7	9593.ENSGGOP00000005255	0.576	Ubiquitin specific peptidase 7 (herpes virus-associated)
8	9593.ENSGGOP00000001497	0.565	Diphthamide biosynthesis 5
9	9593.ENSGGOP00000000316	0.539	Thyroid hormone receptor interactor 12
10	9593.ENSGGOP00000003369	0.528	Ubiquitination factor E4B
11	9593.ENSGGOP00000011138	0.528	Ubiquitination factor E4A
12	9593.ENSGGOP00000027261	0.511	Nucleosome assembly protein 1-like 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.874	multicellular organismal process
GO:0007275	0.853	multicellular organism development
GO:0009987	0.798	cellular process
GO:0065007	0.705	biological regulation
GO:0050789	0.534	regulation of biological process
GO:0050794	0.418	regulation of cellular process
GO:0003008	0.349	system process
GO:0009880	0.336	embryonic pattern specification
GO:0050877	0.325	nervous system process
GO:0050890	0.311	cognition

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	1.000	Golgi apparatus
GO:0005798	0.998	Golgi-associated vesicle
GO:0016020	0.838	membrane
GO:0031090	0.327	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]