StarFunc result for job id Q5JXB2

User Input

>input (153 residues)
MAELPHRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGESKDSPFEGGTFKRELLLA
EEYPMAAPKVRFMTKIYHPNVDKLERISLDILKDKWSPALQIRTVLLSIQALLNAPNPDD
PLANDVVEQWKTNEAQAIETARAWTRLYAMNSI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5JXB2	1.000	1.000	1.191E-31	153	1.000	1.000	Q5JXB2.pdb.gz	UE2NL_HUMAN Putative ubiquitin-conjugating enzyme E2 N-like OS=Homo sapiens OX=9606 GN=UBE2NL PE=1 SV=1
2	AFDB:Q803J2	0.975	0.969	8.722E-28	154	0.895	0.890	Q803J2.pdb.gz	Q803J2_DANRE Ube2n protein OS=Danio rerio OX=7955 GN=ube2n PE=1 SV=1
3	PDB:7bbdC	0.960	0.960	7.081E-26	153	0.908	0.908	7bbdC.pdb.gz	RING domains act as both substrate and enzyme in a catalytic arrangement to drive self-anchored ubiquitination.
4	AFDB:Q95XX0	0.957	0.970	7.931E-26	151	0.797	0.808	Q95XX0.pdb.gz	UBC13_CAEEL Ubiquitin-conjugating enzyme E2 13 OS=Caenorhabditis elegans OX=6239 GN=ubc-13 PE=1 SV=2
5	AFDB:P35128	0.966	0.979	2.235E-25	151	0.732	0.742	P35128.pdb.gz	UBE2N_DROME Ubiquitin-conjugating enzyme E2 N OS=Drosophila melanogaster OX=7227 GN=ben PE=1 SV=1
6	AFDB:F4I615	0.957	0.904	3.689E-24	162	0.725	0.685	F4I615.pdb.gz	F4I615_ARATH Ubiquitin-conjugating enzyme 36 OS=Arabidopsis thaliana OX=3702 GN=UBC36 PE=1 SV=1
7	AFDB:P52490	0.971	0.971	2.296E-23	153	0.641	0.641	P52490.pdb.gz	UBC13_YEAST Ubiquitin-conjugating enzyme E2 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBC13 PE=1 SV=1
8	AFDB:O13685	0.938	0.970	9.455E-22	148	0.608	0.628	O13685.pdb.gz	UBC13_SCHPO Ubiquitin-conjugating enzyme E2 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubc13 PE=1 SV=1
9	AFDB:Q38EF6	0.946	0.964	1.223E-20	150	0.582	0.593	Q38EF6.pdb.gz	Q38EF6_TRYB2 Ubiquitin-conjugating enzyme E2, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.0050 PE=3 SV=1
10	PDB:6zhtB	0.922	0.922	3.926E-20	153	0.641	0.641	6zhtB.pdb.gz
11	AFDB:F4JKF3	0.910	0.785	2.073E-17	178	0.412	0.354	F4JKF3.pdb.gz	F4JKF3_ARATH Ubiquitin conjugating enzyme 9 OS=Arabidopsis thaliana OX=3702 GN=UBC9 PE=3 SV=1
12	AFDB:Q9SLE4	0.905	0.934	2.073E-17	148	0.399	0.412	Q9SLE4.pdb.gz	UBC29_ARATH Ubiquitin-conjugating enzyme E2 29 OS=Arabidopsis thaliana OX=3702 GN=UBC29 PE=2 SV=1
13	PDB:3bzhA	0.897	0.853	9.596E-17	161	0.412	0.391	3bzhA.pdb.gz
14	PDB:4ccgA	0.871	0.850	1.661E-16	157	0.405	0.395	4ccgA.pdb.gz	Structure of the Human Fancl Ring-Ube2T Complex Reveals Determinants of Cognate E3-E2 Selection.
15	PDB:3ptfA	0.894	0.894	2.874E-16	153	0.392	0.392	3ptfA.pdb.gz
16	PDB:4x57C	0.903	0.927	4.680E-16	149	0.412	0.423	4x57C.pdb.gz
17	PDB:6cyrA	0.868	0.868	7.171E-16	153	0.340	0.340	6cyrA.pdb.gz
18	PDB:4ddgA	0.895	0.353	1.099E-15	399	0.412	0.158	4ddgA.pdb.gz
19	PDB:2aakA	0.866	0.882	1.241E-15	150	0.314	0.320	2aakA.pdb.gz
20	PDB:4ii2C	0.888	0.911	1.683E-15	149	0.405	0.416	4ii2C.pdb.gz	Structure of a ubiquitin E1-E2 complex: insights to E1-E2 thioester transfer.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5JXB2	3.48e-111	313	153	1.000	1.000	UE2NL_HUMAN Putative ubiquitin-conjugating enzyme E2 N-like OS=Homo sapiens OX=9606 GN=UBE2NL PE=1 SV=1
2	P61088	1.13e-98	282	152	0.915	0.921	UBE2N_HUMAN Ubiquitin-conjugating enzyme E2 N OS=Homo sapiens OX=9606 GN=UBE2N PE=1 SV=1
3	P61089	1.13e-98	282	152	0.915	0.921	UBE2N_MOUSE Ubiquitin-conjugating enzyme E2 N OS=Mus musculus OX=10090 GN=Ube2n PE=1 SV=1
4	V9HW41	1.13e-98	282	152	0.915	0.921	V9HW41_HUMAN Epididymis secretory protein Li 71 OS=Homo sapiens OX=9606 GN=HEL-S-71 PE=2 SV=1
5	Q9EQX9	4.12e-98	280	152	0.908	0.914	UBE2N_RAT Ubiquitin-conjugating enzyme E2 N OS=Rattus norvegicus OX=10116 GN=Ube2n PE=1 SV=1
6	Q5F405	8.87e-98	280	152	0.908	0.914	Q5F405_CHICK UBC core domain-containing protein OS=Gallus gallus OX=9031 GN=RCJMB04_3o20 PE=2 SV=1
7	Q803J2	2.17e-96	276	154	0.895	0.890	Q803J2_DANRE Ube2n protein OS=Danio rerio OX=7955 GN=ube2n PE=1 SV=1
8	Q95XX0	1.55e-84	246	151	0.784	0.795	UBC13_CAEEL Ubiquitin-conjugating enzyme E2 13 OS=Caenorhabditis elegans OX=6239 GN=ubc-13 PE=1 SV=2
9	P35128	2.81e-81	238	151	0.732	0.742	UBE2N_DROME Ubiquitin-conjugating enzyme E2 N OS=Drosophila melanogaster OX=7227 GN=ben PE=1 SV=1
10	Q94A97	3.35e-78	230	153	0.706	0.706	UBC35_ARATH Ubiquitin-conjugating enzyme E2 35 OS=Arabidopsis thaliana OX=3702 GN=UBC35 PE=1 SV=1
11	F4I615	2.09e-75	223	162	0.712	0.673	F4I615_ARATH Ubiquitin-conjugating enzyme 36 OS=Arabidopsis thaliana OX=3702 GN=UBC36 PE=1 SV=1
12	P52490	2.34e-67	203	153	0.641	0.641	UBC13_YEAST Ubiquitin-conjugating enzyme E2 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBC13 PE=1 SV=1
13	O13685	5.07e-61	187	148	0.608	0.628	UBC13_SCHPO Ubiquitin-conjugating enzyme E2 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubc13 PE=1 SV=1
14	Q38EF6	3.85e-58	179	150	0.569	0.580	Q38EF6_TRYB2 Ubiquitin-conjugating enzyme E2, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.0050 PE=3 SV=1
15	F8VSD4	7.89e-55	169	105	0.621	0.905	F8VSD4_HUMAN Ubiquitin conjugating enzyme E2 N OS=Homo sapiens OX=9606 GN=UBE2N PE=1 SV=1
16	F8VV71	7.57e-54	169	152	0.549	0.553	F8VV71_HUMAN Ubiquitin conjugating enzyme E2 N OS=Homo sapiens OX=9606 GN=UBE2N PE=1 SV=1
17	Q84K93	3.50e-38	129	148	0.425	0.439	Q84K93_GOSHI Ubiquitin-conjugating enzyme E2 OS=Gossypium hirsutum OX=3635 GN=UBC2 PE=2 SV=1
18	Q8S920	2.17e-37	127	147	0.425	0.442	UBC5A_ORYSJ Ubiquitin-conjugating enzyme E2 5A OS=Oryza sativa subsp. japonica OX=39947 GN=UBC5A PE=2 SV=1
19	P35134	2.33e-37	127	148	0.412	0.426	UBC11_ARATH Ubiquitin-conjugating enzyme E2 11 OS=Arabidopsis thaliana OX=3702 GN=UBC11 PE=1 SV=2
20	Q8S919	3.89e-37	126	148	0.412	0.426	UBC5B_ORYSJ Ubiquitin-conjugating enzyme E2 5B OS=Oryza sativa subsp. japonica OX=39947 GN=UBC5B PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00179 UQ_con	1.9e-35	133.0	Ubiquitin-conjugating enzyme

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000047232

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000006096	0.990	Belongs to the TNF receptor-associated factor family.
2	9598.ENSPTRP00000034647	0.988	Uncharacterized protein
3	9598.ENSPTRP00000006562	0.980	Ubiquitin thioesterase
4	9598.ENSPTRP00000012898	0.974	STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase
5	9598.ENSPTRP00000057853	0.962	E3 ubiquitin-protein ligase RNF8
6	9598.ENSPTRP00000027688	0.937	Ubiquitin-like modifier activating enzyme 6
7	9598.ENSPTRP00000032068	0.926	E3 ubiquitin-protein ligase parkin
8	9598.ENSPTRP00000046096	0.924	Helicase-like transcription factor
9	9598.ENSPTRP00000016020	0.919	Tripartite motif containing 25
10	9598.ENSPTRP00000023422	0.913	Pan troglodytes ubiquitin-conjugating enzyme E2 variant 1 (UBE2V1), mRNA
11	9598.ENSPTRP00000060271	0.903	Ubiquitin A-52 residue ribosomal protein fusion product 1
12	9598.ENSPTRP00000027157	0.902	E3 ubiquitin-protein ligase RNF168
13	9598.ENSPTRP00000020489	0.900	Pan troglodytes ribosomal protein S27a (RPS27A), mRNA
14	9598.ENSPTRP00000060412	0.900	Uncharacterized protein
15	9598.ENSPTRP00000022237	0.899	Thyroid hormone receptor interactor 12
16	9598.ENSPTRP00000061184	0.898	Inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma
17	9598.ENSPTRP00000050925	0.889	Polyubiquitin-C
18	9598.ENSPTRP00000055212	0.889	annotation not available
19	9598.ENSPTRP00000059656	0.885	Uncharacterized protein
20	9598.ENSPTRP00000006709	0.847	K(lysine) acetyltransferase 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004842	1.000	ubiquitin-protein transferase activity
GO:0061650	0.885	ubiquitin-like protein conjugating enzyme activity
GO:0061631	0.545	ubiquitin conjugating enzyme activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0019538	0.995	protein metabolic process
GO:0036211	0.983	protein modification process
GO:0044237	0.973	cellular metabolic process
GO:0070647	0.970	protein modification by small protein conjugation or removal
GO:0044260	0.960	cellular macromolecule metabolic process
GO:0032446	0.894	protein modification by small protein conjugation
GO:0065007	0.869	biological regulation
GO:0016567	0.820	protein ubiquitination
GO:0050896	0.816	response to stimulus
GO:0050789	0.816	regulation of biological process
GO:0051716	0.729	cellular response to stimulus
GO:0006950	0.688	response to stress
GO:0050794	0.621	regulation of cellular process
GO:0019222	0.550	regulation of metabolic process
GO:0060255	0.541	regulation of macromolecule metabolic process
GO:0033554	0.504	cellular response to stress
GO:0080090	0.497	regulation of primary metabolic process
GO:0051171	0.497	regulation of nitrogen compound metabolic process
GO:0048518	0.470	positive regulation of biological process
GO:0048522	0.361	positive regulation of cellular process
GO:0048583	0.352	regulation of response to stimulus
GO:0006508	0.342	proteolysis
GO:0006281	0.342	DNA repair
GO:0030163	0.338	protein catabolic process
GO:0044248	0.322	cellular catabolic process
GO:0031323	0.317	regulation of cellular metabolic process
GO:0009893	0.313	positive regulation of metabolic process
GO:0044265	0.309	cellular macromolecule catabolic process
GO:0051603	0.301	proteolysis involved in protein catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.999	membrane-bounded organelle
GO:0005622	0.996	intracellular anatomical structure
GO:0043231	0.989	intracellular membrane-bounded organelle
GO:0031982	0.972	vesicle
GO:0032991	0.969	protein-containing complex
GO:0005654	0.966	nucleoplasm
GO:0005829	0.925	cytosol
GO:0005576	0.845	extracellular region
GO:0005615	0.804	extracellular space
GO:0070062	0.765	extracellular exosome
GO:1902494	0.658	catalytic complex
GO:1990234	0.398	transferase complex
GO:0140535	0.317	intracellular protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.
EC:2.3.2.23	0.545	E2 ubiquitin-conjugating enzyme.

[back to server]