StarFunc result for job id Q5JY77

User Input

>input (1395 residues)
MTGAEIESGAQVKPEKKPGEEVVGGAEIENDVPLVVRPKVRTQAQIMPGARPKNKSKVMP
GASTKVETSAVGGARPKSKAKAIPVSRFKEEAQMWAQPRFGAERLSKTERNSQTNIIASP
LVSTDSVLVAKTKYLSEDRELVNTDTESFPRRKAHYQAGFQPSFRSKEETNMGSWCCPRP
TSKQEASPNSDFKWVDKSVSSLFWSGDEVTAKFHPGNRVKDSNRSMHMANQEANTMSRSQ
TNQELYIASSSGSEDESVKTPWFWARDKTNTWSGPREDPNSRSRFRSKKEVYVESSSGSE
HEDHLESWFGAGKEAKFRSKMRAGKEANNRARHRAKREACIDFMPGSIDVIKKESCFWPE
ENANTFSRPMIKKEARARAMTKEEAKTKARARAKQEARSEEEALIGTWFWATDESSMADE
ASIESSLQVEDESIIGSWFWTEEEASMGTGASSKSRPRTDGERIGDSLFGAREKTSMKTG
AEATSESILAADDEQVIIGSWFWAGEEVNQEAEEETIFGSWFWVIDAASVESGVGVSCES
RTRSEEEEVIGPWFWSGEQVDIEAGIGEEARPGAEEETIFGSWFWAENQTYMDCRAETSC
DTMQGAEEEEPIIGSWFWTRVEACVEGDVNSKSSLEDKEEAMIPCFGAKEEVSMKHGTGV
RCRFMAGAEETNNKSCFWAEKEPCMYPAGGGSWKSRPEEEEDIVNSWFWSRKYTKPEAII
GSWLWATEESNIDGTGEKAKLLTEEETIINSWFWKEDEAISEATDREESRPEAEEGDIIG
SWFWAGEEDRLEPAAETREEDRLAAEKEGIVGSWFGAREETIRREAGSCSKSSPKAEEEE
VIIGSWFWEEEASPEAVAGVGFESKPGTEEEEITVGSWFWPEEEASIQAGSQAVEEMESE
TEEETIFGSWFWDGKEVSEEAGPCCVSKPEDDEEMIVESWFWSRDKAIKETGTVATCESK
PENEEGAIVGSWFEAEDEVDNRTDNGSNCGSRTLADEDEAIVGSWFWAGDEAHFESNPSP
VFRAICRSTCSVEQEPDPSRRPQSWEEVTVQFKPGPWGRVGFPSISPFRFPKEAASLFCE
MFGGKPRNMVLSPEGEDQESLLQPDQPSPEFPFQYDPSYRSVQEIREHLRAKESTEPESS
SCNCIQCELKIGSEEFEELLLLMEKIRDPFIHEISKIAMGMRSASQFTRDFIRDSGVVSL
IETLLNYPSSRVRTSFLENMIRMAPPYPNLNIIQTYICKVCEETLAYSVDSPEQLSGIRM
IRHLTTTTDYHTLVANYMSGFLSLLATGNAKTRFHVLKMLLNLSENLFMTKELLSAEAVS
EFIGLFNREETNDNIQIVLAIFENIGNNIKKETVFSDDDFNIEPLISAFHKVEKFAKELQ
GKTDNQNDPEGDQEN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5JY77	1.000	1.000	0.000	1395	1.000	1.000	Q5JY77.pdb.gz	GASP1_HUMAN G-protein coupled receptor-associated sorting protein 1 OS=Homo sapiens OX=9606 GN=GPRASP1 PE=1 SV=3
2	AFDB:Q5U4C1	0.144	0.148	6.669E-72	1347	0.578	0.599	Q5U4C1.pdb.gz	GASP1_MOUSE G-protein coupled receptor-associated sorting protein 1 OS=Mus musculus OX=10090 GN=Gprasp1 PE=1 SV=1
3	AFDB:Q920R4	0.142	0.146	1.002E-70	1346	0.575	0.596	Q920R4.pdb.gz	GASP1_RAT G-protein coupled receptor-associated sorting protein 1 OS=Rattus norvegicus OX=10116 GN=Gprasp1 PE=1 SV=1
4	AFDB:Q5H9R4	0.122	0.082	8.433E-14	2290	0.222	0.135	Q5H9R4.pdb.gz	ARMX4_HUMAN Armadillo repeat-containing X-linked protein 4 OS=Homo sapiens OX=9606 GN=ARMCX4 PE=1 SV=3
5	AFDB:Q9VCH1	0.072	0.054	4.008E-4	2072	0.130	0.088	Q9VCH1.pdb.gz	Q9VCH1_DROME Eukaryotic translation initiation factor 4G2, isoform A OS=Drosophila melanogaster OX=7227 GN=eIF4G2 PE=1 SV=2
6	AFDB:Q8MQW8	0.053	0.045	3.279E-3	1789	0.126	0.098	Q8MQW8.pdb.gz	SPRI_DROME Protein sprint OS=Drosophila melanogaster OX=7227 GN=spri PE=2 SV=3
7	AFDB:A8DZ29	0.073	0.057	8.746E-3	1919	0.123	0.090	A8DZ29.pdb.gz	A8DZ29_DROME Eukaryotic translation initiation factor 4G1, isoform B OS=Drosophila melanogaster OX=7227 GN=eIF4G1 PE=1 SV=1
8	PDB:6kbnC	0.104	0.243	1.302E-2	504	0.022	0.060	6kbnC.pdb.gz	Quaternary structures of Vac8 differentially regulate the Cvt and PMN pathways.
9	AFDB:Q76E23	0.083	0.071	1.532E-2	1727	0.125	0.101	Q76E23.pdb.gz	IF4G_ARATH Eukaryotic translation initiation factor 4G OS=Arabidopsis thaliana OX=3702 GN=EIF4G PE=1 SV=2
10	PDB:7cm7A	0.097	0.199	1.893E-2	620	0.025	0.056	7cm7A.pdb.gz	The NAD + -mediated self-inhibition mechanism of pro-neurodegenerative SARM1.
11	PDB:6wm2P	0.094	0.263	2.505E-2	427	0.028	0.091	6wm2P.pdb.gz	Structures of a Complete Human V-ATPase Reveal Mechanisms of Its Assembly.
12	AFDB:E5FYH1	0.063	0.058	3.552E-2	1653	0.133	0.112	E5FYH1.pdb.gz	TOPZ1_MOUSE Protein TOPAZ1 OS=Mus musculus OX=10090 GN=Topaz1 PE=2 SV=1
13	AFDB:A0A0R4IZ84	0.055	0.052	5.666E-2	1544	0.100	0.091	A0A0R4IZ84.pdb.gz	EST1A_DANRE Telomerase-binding protein EST1A OS=Danio rerio OX=7955 GN=smg6 PE=2 SV=1
14	PDB:3tpoA	0.111	0.284	5.807E-2	438	0.029	0.091	3tpoA.pdb.gz
15	PDB:5voxP	0.096	0.238	6.680E-2	462	0.029	0.087	5voxP.pdb.gz
16	PDB:1wa5B	0.111	0.283	1.170E-1	466	0.035	0.105	1wa5B.pdb.gz	Structural basis for the assembly of a nuclear export complex.
17	PDB:7dvqK	0.081	0.531	1.549E-1	188	0.011	0.085	7dvqK.pdb.gz	Structure of the activated human minor spliceosome.
18	PDB:4i2wA	0.086	0.128	1.623E-1	904	0.030	0.046	4i2wA.pdb.gz	The myosin chaperone UNC-45 is organized in tandem modules to support myofilament formation in C. elegans.
19	PDB:4zdrA	0.059	0.219	1.782E-1	243	0.026	0.148	4zdrA.pdb.gz	Structure of the 14-3-3 zeta-LKB1 fusion protein provides insight into a novel ligand-binding mode of 14-3-3.
20	PDB:5tbkA	0.107	0.305	1.782E-1	417	0.027	0.089	5tbkA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5JY77	0.0	2831	1395	1.000	1.000	GASP1_HUMAN G-protein coupled receptor-associated sorting protein 1 OS=Homo sapiens OX=9606 GN=GPRASP1 PE=1 SV=3
2	Q5U4C1	0.0	1415	1347	0.573	0.594	GASP1_MOUSE G-protein coupled receptor-associated sorting protein 1 OS=Mus musculus OX=10090 GN=Gprasp1 PE=1 SV=1
3	Q8BUY8	0.0	571	826	0.201	0.339	GASP2_MOUSE G-protein coupled receptor-associated sorting protein 2 OS=Mus musculus OX=10090 GN=Gprasp2 PE=1 SV=2
4	Q920R4	0.0	1419	1346	0.569	0.590	GASP1_RAT G-protein coupled receptor-associated sorting protein 1 OS=Rattus norvegicus OX=10116 GN=Gprasp1 PE=1 SV=1
5	Q96D09	0.0	627	838	0.264	0.439	GASP2_HUMAN G-protein coupled receptor-associated sorting protein 2 OS=Homo sapiens OX=9606 GN=GPRASP2 PE=1 SV=1
6	Q6PI77	3.18e-65	234	547	0.114	0.291	GASP3_HUMAN G protein-coupled receptor associated sorting protein 3 OS=Homo sapiens OX=9606 GN=GPRASP3 PE=1 SV=1
7	Q6PB60	1.38e-59	217	539	0.101	0.262	GASP3_MOUSE G protein-coupled receptor associated sorting protein 3 OS=Mus musculus OX=10090 GN=Gprasp3 PE=1 SV=1
8	Q6P1M9	3.04e-54	202	558	0.092	0.231	ARMX5_HUMAN Armadillo repeat-containing X-linked protein 5 OS=Homo sapiens OX=9606 GN=ARMCX5 PE=1 SV=1
9	Q5H9R4	1.99e-52	206	2290	0.075	0.045	ARMX4_HUMAN Armadillo repeat-containing X-linked protein 4 OS=Homo sapiens OX=9606 GN=ARMCX4 PE=1 SV=3
10	Q9P291	1.43e-33	138	453	0.052	0.161	ARMX1_HUMAN Armadillo repeat-containing X-linked protein 1 OS=Homo sapiens OX=9606 GN=ARMCX1 PE=1 SV=1
11	Q9CX83	1.86e-31	132	456	0.047	0.143	ARMX1_MOUSE Armadillo repeat-containing X-linked protein 1 OS=Mus musculus OX=10090 GN=Armcx1 PE=1 SV=1
12	Q9D0L7	2.46e-30	125	306	0.047	0.212	ARM10_MOUSE Armadillo repeat-containing protein 10 OS=Mus musculus OX=10090 GN=Armc10 PE=1 SV=1
13	Q8N2F6	8.82e-29	121	343	0.045	0.184	ARM10_HUMAN Armadillo repeat-containing protein 10 OS=Homo sapiens OX=9606 GN=ARMC10 PE=1 SV=1
14	Q9UH62	4.35e-28	120	379	0.052	0.190	ARMX3_HUMAN Armadillo repeat-containing X-linked protein 3 OS=Homo sapiens OX=9606 GN=ARMCX3 PE=1 SV=1
15	Q8BHS6	9.54e-28	119	379	0.052	0.190	ARMX3_MOUSE Armadillo repeat-containing X-linked protein 3 OS=Mus musculus OX=10090 GN=Armcx3 PE=1 SV=1
16	H7C2M7	2.94e-09	60.5	185	0.025	0.189	H7C2M7_HUMAN Armadillo repeat containing 10 (Fragment) OS=Homo sapiens OX=9606 GN=ARMC10 PE=1 SV=1
17	Q57TX7	0.028	41.6	2197	0.101	0.064	Q57TX7_TRYB2 Kinetoplast DNA-associated protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.30D13.380 PE=4 SV=1
18	H0Y6I0	0.96	36.6	2250	0.014	0.008	H0Y6I0_HUMAN Golgi autoantigen, golgin subfamily a, 4, isoform CRA_a OS=Homo sapiens OX=9606 GN=GOLGA4 PE=1 SV=2
19	Q13439	1.1	36.2	2230	0.014	0.009	GOGA4_HUMAN Golgin subfamily A member 4 OS=Homo sapiens OX=9606 GN=GOLGA4 PE=1 SV=1
20	P9WG47	3.7	34.3	838	0.037	0.061	GYRA_MYCTU DNA gyrase subunit A OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=gyrA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04826 Arm_2	7.4e-53	190.9	Armadillo-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000445683

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000234961	0.788	Delta-type opioid receptor
2	9606.ENSP00000394624	0.781	Mu-type opioid receptor
3	9606.ENSP00000443410	0.757	Putative nucleotidyltransferase FAM46D
4	9606.ENSP00000437872	0.744	G-protein coupled receptor-associated sorting protein 2
5	9606.ENSP00000361728	0.739	Protein BEX3
6	9606.ENSP00000442521	0.714	Protein BEX2
7	9606.ENSP00000477981	0.714	Brain mitochondrial carrier protein 1
8	9606.ENSP00000452280	0.711	Prostaglandin reductase 2
9	9606.ENSP00000361813	0.706	Protein BEX1
10	9606.ENSP00000326340	0.684	Autophagy-related protein 16-2
11	9606.ENSP00000341680	0.682	Dysbindin
12	9606.ENSP00000249700	0.656	Tropomodulin-2
13	9606.ENSP00000305372	0.656	Beta-2 adrenergic receptor
14	9606.ENSP00000351805	0.642	Vasopressin V2 receptor
15	9606.ENSP00000290541	0.623	Proteasome subunit beta type-4
16	9606.ENSP00000358301	0.607	Beta-1 adrenergic receptor
17	9606.ENSP00000176183	0.575	Dopamine receptor D4
18	9606.ENSP00000358513	0.564	Cannabinoid receptor 1
19	9606.ENSP00000361866	0.538	Transcription elongation factor A protein-like 2
20	9606.ENSP00000319635	0.517	C-X-C chemokine receptor type 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050794	0.993	regulation of cellular process
GO:0048519	0.979	negative regulation of biological process
GO:0008152	0.976	metabolic process
GO:0071704	0.972	organic substance metabolic process
GO:0048523	0.971	negative regulation of cellular process
GO:0044237	0.967	cellular metabolic process
GO:0009966	0.957	regulation of signal transduction
GO:0006810	0.952	transport
GO:0023057	0.945	negative regulation of signaling
GO:0008277	0.926	regulation of G protein-coupled receptor signaling pathway
GO:0007034	0.917	vacuolar transport
GO:0043170	0.915	macromolecule metabolic process
GO:0044260	0.900	cellular macromolecule metabolic process
GO:0009968	0.892	negative regulation of signal transduction
GO:0016192	0.876	vesicle-mediated transport
GO:0043112	0.830	receptor metabolic process
GO:0007041	0.814	lysosomal transport
GO:0045744	0.813	negative regulation of G protein-coupled receptor signaling pathway
GO:0008333	0.790	endosome to lysosome transport
GO:0044248	0.358	cellular catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005829	0.994	cytosol
GO:0043229	0.958	intracellular organelle
GO:0016020	0.951	membrane
GO:0043231	0.950	intracellular membrane-bounded organelle
GO:0005886	0.936	plasma membrane
GO:0005634	0.798	nucleus
GO:0070013	0.535	intracellular organelle lumen
GO:0031981	0.528	nuclear lumen
GO:0005654	0.512	nucleoplasm
GO:0012505	0.329	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]