StarFunc result for job id Q5JYT7

User Input

>input (1200 residues)
MDPPSLDTAIQHALAGLYPPFEATAPTVLGQVFRLLDSGFQGDGLSFLLDFLIPAKRLCE
QVREAACAPYSHCLFLHEGWPLCLRDEVVVHLAPLNPLLLRQGDFYLQVEPQEEQSVCIM
IKCLSLDLCTVDKKPVPEPAYPILFTQEWLEAINSDFEGNPLHNCLVASENGIAPVPWTK
ITSPEFVDDRPQVVNALCQAWGPLPLEALDLSSPQELHQASSPDNQVLPAQSLAKGKGRT
YGSKYPGLIKVEQARCGEVAFRMDEVVSQDFEGDYVALLGFSQESRGESPSREAGTSSGC
TSGALEEIAGTKETPLFQKILPLSEANEGPSLGNRACTKPESSEERPYNLGFRRKVNLKA
PTHNSERPPQGSYMNVLEDALDCASGLRAGVSQEPAASKMQGPLGNPENMVQLRPGPRQA
SSPRLSPASPAAAASETKIEVKTKERNGRLPKPMPCPSRNTSSPEPPTPGLKFSFLRGQR
QPSVTPEKASLQHNGPWKVLCSLYSPKPNRAKSLGKAGTTQTKTSGPATAPSPLTEEKAA
LPEASAGSPERGPTLEEEPPGPEPRIGALGVKVFRSRIACLPGGRDRAGRPLLLVSTTEG
AWEAPWCTVSEVTKLLSYLCTIPRPEDKAKGLAVLIDARRQPPQPGLVSALQATQAQVPA
SIRAILFLGEKEAALQLQTLPDVQVEVLTSLKALSHHVDPSQLPAVLEGPFPYCHTEWVH
FFQKLDPFLADLHQASSLLQASIEEFEKADPPGGMQEATRCLSKSKELMEAVLRDPGLLG
LQREGGATLARLQHDASRLDFSPDVRSHLAAATALYSLVDEQLHVLVTASNSLLGKLELR
VRLGRLEAAIHQVSDWMEQEGRRCLQSLTPKDGSLETVEKAHAEFENFFLQAAAQYRRGL
ELSKQAAQLGATARGAGEAERAEFPELAAFASTQRAFQAELTHFYMAAERQRTDLETLLH
LHRFCKRMTWFHMDCQDLMAQLRLDKTSRVSPGDQRRLHRYLQRLASEFPAEKLAAVGLQ
VASLSRAGLGQELWEEARIRHEEIRMLLEKALTHSSCPEAPAAHSARPERRGVAAKGQGV
SVEVTSKGRWDQPPLDSLGMDHLPKSYWPPGPPRGEQNRTFQAGSPPQEAGQAAEAEDGK
GSHKLPDPAREHLLATTFFRQQPPRQSQVPRLTGGSFSSEGTDSQTSLEDSPQTSPLASL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TER5	0.249	0.209	5.132E-43	1519	0.247	0.196	Q8TER5.pdb.gz	ARH40_HUMAN Rho guanine nucleotide exchange factor 40 OS=Homo sapiens OX=9606 GN=ARHGEF40 PE=1 SV=3
2	AFDB:Q99569	0.052	0.052	8.989E-5	1192	0.125	0.126	Q99569.pdb.gz	PKP4_HUMAN Plakophilin-4 OS=Homo sapiens OX=9606 GN=PKP4 PE=1 SV=2
3	AFDB:Q8K1N2	0.047	0.045	1.074E-4	1249	0.124	0.119	Q8K1N2.pdb.gz	PHLB2_MOUSE Pleckstrin homology-like domain family B member 2 OS=Mus musculus OX=10090 GN=Phldb2 PE=1 SV=2
4	AFDB:Q86SQ0	0.045	0.044	3.731E-4	1253	0.110	0.105	Q86SQ0.pdb.gz	PHLB2_HUMAN Pleckstrin homology-like domain family B member 2 OS=Homo sapiens OX=9606 GN=PHLDB2 PE=1 SV=2
5	PDB:7wvtA	0.116	0.337	8.978E-4	364	0.031	0.102	7wvtA.pdb.gz	Structural basis of ligand recognition and transport by Sfh2, a yeast phosphatidylinositol transfer protein of the Sec14 superfamily.
6	AFDB:P34333	0.043	0.032	1.619E-3	1778	0.121	0.082	P34333.pdb.gz	NCOR1_CAEEL Nuclear receptor corepressor 1 OS=Caenorhabditis elegans OX=6239 GN=gei-8 PE=1 SV=4
7	AFDB:O08815	0.064	0.063	1.769E-3	1206	0.117	0.117	O08815.pdb.gz	SLK_RAT STE20-like serine/threonine-protein kinase OS=Rattus norvegicus OX=10116 GN=Slk PE=1 SV=1
8	AFDB:Q80XI3	0.053	0.044	3.604E-3	1579	0.133	0.101	Q80XI3.pdb.gz	IF4G3_MOUSE Eukaryotic translation initiation factor 4 gamma 3 OS=Mus musculus OX=10090 GN=Eif4g3 PE=1 SV=2
9	AFDB:M9PGK7	0.116	0.072	5.379E-3	2272	0.114	0.060	M9PGK7.pdb.gz	M9PGK7_DROME Klarsicht, isoform E OS=Drosophila melanogaster OX=7227 GN=klar PE=1 SV=1
10	AFDB:Q9UPV0	0.050	0.042	6.146E-3	1460	0.179	0.147	Q9UPV0.pdb.gz	CE164_HUMAN Centrosomal protein of 164 kDa OS=Homo sapiens OX=9606 GN=CEP164 PE=1 SV=3
11	AFDB:Q8IN05	0.064	0.057	8.026E-3	1415	0.110	0.093	Q8IN05.pdb.gz	Q8IN05_DROME Liquid facets-Related, isoform D OS=Drosophila melanogaster OX=7227 GN=lqfR PE=1 SV=2
12	PDB:3w68C	0.122	0.505	1.353E-2	252	0.023	0.111	3w68C.pdb.gz	Impaired alpha-TTP-PIPs interaction underlies familial vitamin E deficiency
13	PDB:4uybA	0.103	0.280	1.690E-2	401	0.022	0.067	4uybA.pdb.gz
14	PDB:1oizA	0.111	0.440	1.847E-2	265	0.024	0.109	1oizA.pdb.gz	The Molecular Basis of Vitamin E Retention: Structure of Human Alpha-Tocopherol Transfer Protein
15	PDB:4tlgA	0.103	0.284	2.111E-2	396	0.019	0.058	4tlgA.pdb.gz	Crystal structure of SEC14-like protein 4 (SEC14L4)
16	PDB:4cizA	0.109	0.404	2.207E-2	284	0.026	0.109	4cizA.pdb.gz	Human Cellular Retinaldehyde-Binding Protein Has Secondary Thermal 9-Cis-Retinal Isomerase Activity.
17	PDB:3b7nA	0.102	0.341	3.013E-2	307	0.018	0.068	3b7nA.pdb.gz	Functional anatomy of phospholipid binding and regulation of phosphoinositide homeostasis by proteins of the sec14 superfamily
18	PDB:1olmE	0.107	0.295	3.150E-2	397	0.019	0.058	1olmE.pdb.gz	Supernatant Protein Factor in Complex with Rrr-Alpha-Tocopherylquinone: A Link between Oxidized Vitamin E and Cholesterol Biosynthesis
19	PDB:4fmmB	0.091	0.285	3.600E-2	325	0.028	0.105	4fmmB.pdb.gz	Dimeric Sfh3 has structural changes in its binding pocket that are associated with a dimer-monomer state transformation induced by substrate binding.
20	PDB:1sjjA	0.137	0.174	5.616E-2	863	0.045	0.063	1sjjA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6DN89	4.18e-60	229	1989	0.148	0.089	Q6DN89_DANRE Quattro OS=Danio rerio OX=7955 GN=sb:cb9 PE=2 SV=1
2	Q8TER5	1.08e-47	189	1519	0.077	0.061	ARH40_HUMAN Rho guanine nucleotide exchange factor 40 OS=Homo sapiens OX=9606 GN=ARHGEF40 PE=1 SV=3
3	Q96PX9	1.96e-45	181	1271	0.095	0.090	PKH4B_HUMAN Pleckstrin homology domain-containing family G member 4B OS=Homo sapiens OX=9606 GN=PLEKHG4B PE=1 SV=4
4	Q58EX7	1.34e-43	175	1191	0.108	0.109	PKHG4_HUMAN Puratrophin-1 OS=Homo sapiens OX=9606 GN=PLEKHG4 PE=1 SV=1
5	F8VPS6	3.01e-42	171	1181	0.108	0.110	F8VPS6_MOUSE Pleckstrin homology domain containing, family G (with RhoGef domain) member 4 OS=Mus musculus OX=10090 GN=Plekhg4 PE=1 SV=1
6	O15068	1.31e-13	78.2	1137	0.095	0.100	MCF2L_HUMAN Guanine nucleotide exchange factor DBS OS=Homo sapiens OX=9606 GN=MCF2L PE=1 SV=2
7	O61528	1.80e-13	78.2	2488	0.070	0.034	O61528_CAEEL CRAL-TRIO domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-73 PE=1 SV=1
8	Q64096	2.04e-13	77.8	1149	0.079	0.083	MCF2L_MOUSE Guanine nucleotide exchange factor DBS OS=Mus musculus OX=10090 GN=Mcf2l PE=1 SV=2
9	Q6PDM6	2.46e-13	77.4	1166	0.078	0.081	Q6PDM6_MOUSE Mcf.2 transforming sequence-like OS=Mus musculus OX=10090 GN=Mcf2l PE=1 SV=1
10	C4ALD5	4.05e-13	77.0	2140	0.070	0.039	C4ALD5_CAEEL CRAL-TRIO domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-73 PE=1 SV=1
11	Q63406	7.42e-13	75.9	1149	0.078	0.082	MCF2L_RAT Guanine nucleotide exchange factor DBS OS=Rattus norvegicus OX=10116 GN=Mcf2l PE=1 SV=3
12	Q7KPP4	8.54e-13	75.9	1638	0.070	0.051	Q7KPP4_CAEEL CRAL-TRIO domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-73 PE=1 SV=1
13	A0A2R8RHL8	6.26e-11	69.7	2306	0.079	0.041	A0A2R8RHL8_DANRE Kalirin RhoGEF kinase b OS=Danio rerio OX=7955 GN=wu:fc60a10 PE=4 SV=1
14	O75962	6.89e-11	69.7	3097	0.047	0.018	TRIO_HUMAN Triple functional domain protein OS=Homo sapiens OX=9606 GN=TRIO PE=1 SV=2
15	F1M0Z1	8.65e-11	69.3	3100	0.047	0.018	TRIO_RAT Triple functional domain protein OS=Rattus norvegicus OX=10116 GN=Trio PE=1 SV=4
16	Q0KL02	9.10e-11	69.3	3102	0.047	0.018	TRIO_MOUSE Triple functional domain protein OS=Mus musculus OX=10090 GN=Trio PE=1 SV=3
17	A2CG49	2.31e-10	67.8	2964	0.068	0.027	KALRN_MOUSE Kalirin OS=Mus musculus OX=10090 GN=Kalrn PE=1 SV=1
18	H7BXZ5	2.71e-10	67.8	2955	0.068	0.027	H7BXZ5_HUMAN non-specific serine/threonine protein kinase (Fragment) OS=Homo sapiens OX=9606 GN=KALRN PE=1 SV=1
19	O60229	3.08e-10	67.4	2986	0.068	0.027	KALRN_HUMAN Kalirin OS=Homo sapiens OX=9606 GN=KALRN PE=1 SV=3
20	Q8BLE2	1.56e-09	65.1	1031	0.057	0.066	Q8BLE2_MOUSE Mcf.2 transforming sequence OS=Mus musculus OX=10090 GN=Mcf2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11293 DUF3094	1.5e+02	13.4	Protein of unknown function (DUF3094)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000279024

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000348842	0.763	Echinoderm microtubule-associated protein-like 6
2	9606.ENSP00000261486	0.609	Erythrocyte membrane protein band 4.1 like 4A
3	9606.ENSP00000230671	0.576	Sodium-dependent proline transporter
4	9606.ENSP00000476313	0.562	Olfactory receptor 8G1
5	9606.ENSP00000362560	0.547	V-set and transmembrane domain-containing protein 2-like protein
6	9606.ENSP00000363023	0.540	Disks large-associated protein 4
7	9606.ENSP00000421853	0.534	Ran-binding protein 3-like
8	9606.ENSP00000309161	0.506	Zinc finger protein 471
9	9606.ENSP00000322730	0.501	Integral membrane protein 2C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005085	0.999	guanyl-nucleotide exchange factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.976	regulation of biological process
GO:0050794	0.971	regulation of cellular process
GO:0023051	0.639	regulation of signaling
GO:0010646	0.639	regulation of cell communication
GO:0048583	0.613	regulation of response to stimulus
GO:0009966	0.547	regulation of signal transduction
GO:0009987	0.474	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0016020	0.987	membrane
GO:0005829	0.940	cytosol
GO:0043229	0.669	intracellular organelle
GO:0071944	0.510	cell periphery
GO:0005886	0.500	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]