StarFunc result for job id Q5JZY3

User Input

>input (1008 residues)
METCAGPHPLRLFLCRMQLCLALLLGPWRPGTAEEVILLDSKASQAELGWTALPSNGWEE
ISGVDEHDRPIRTYQVCNVLEPNQDNWLQTGWISRGRGQRIFVELQFTLRDCSSIPGAAG
TCKETFNVYYLETEADLGRGRPRLGGSRPRKIDTIAADESFTQGDLGERKMKLNTEVREI
GPLSRRGFHLAFQDVGACVALVSVRVYYKQCRATVRGLATFPATAAESAFSTLVEVAGTC
VAHSEGEPGSPPRMHCGADGEWLVPVGRCSCSAGFQERGDFCEACPPGFYKVSPRRPLCS
PCPEHSRALENASTFCVCQDSYARSPTDPPSASCTRPPSAPRDLQYSLSRSPLVLRLRWL
PPADSGGRSDVTYSLLCLRCGREGPAGACEPCGPRVAFLPRQAGLRERAATLLHLRPGAR
YTVRVAALNGVSGPAAAAGTTYAQVTVSTGPGAPWEEDEIRRDRVEPQSVSLSWREPIPA
GAPGANDTEYEIRYYEKGQSEQTYSMVKTGAPTVTVTNLKPATRYVFQIRAASPGPSWEA
QSFNPSIEVQTLGEAASGSRDQSPAIVVTVVTISALLVLGSVMSVLAIWRRPCSYGKGGG
DAHDEEELYFHFKVPTRRTFLDPQSCGDLLQAVHLFAKELDAKSVTLERSLGGGRFGELC
CGCLQLPGRQELLVAVHMLRDSASDSQRLGFLAEALTLGQFDHSHIVRLEGVVTRGSTLM
IVTEYMSHGALDGFLRRHEGQLVAGQLMGLLPGLASAMKYLSEMGYVHRGLAARHVLVSS
DLVCKISGFGRGPRDRSEAVYTTMSGRSPALWAAPETLQFGHFSSASDVWSFGIIMWEVM
AFGERPYWDMSGQDVIKAVEDGFRLPPPRNCPNLLHRLMLDCWQKDPGERPRFSQIHSIL
SKMVQDPEPPKCALTTCPRPPTPLADRAFSTFPSFGSVGAWLEALDLCRYKDSFAAAGYG
SLEAVAEMTAQDLVSLGISLAEHREALLSGISALQARVLQLQGQGVQV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0B4J1T8	0.411	0.374	0.000	1130	0.438	0.390	A0A0B4J1T8.pdb.gz	A0A0B4J1T8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA6 PE=1 SV=1
2	AFDB:A0A0G2JY48	0.376	0.383	0.000	986	0.422	0.431	A0A0G2JY48.pdb.gz	A0A0G2JY48_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=1 SV=2
3	AFDB:F1Q9D9	0.435	0.454	0.000	963	0.454	0.476	F1Q9D9.pdb.gz
4	AFDB:F1RCL1	0.598	0.614	0.000	976	0.434	0.448	F1RCL1.pdb.gz
5	AFDB:O08680	0.396	0.405	0.000	984	0.462	0.474	O08680.pdb.gz	EPHA3_RAT Ephrin type-A receptor 3 OS=Rattus norvegicus OX=10116 GN=Epha3 PE=2 SV=1
6	AFDB:P29322	0.575	0.576	0.000	1005	0.455	0.457	P29322.pdb.gz	EPHA8_HUMAN Ephrin type-A receptor 8 OS=Homo sapiens OX=9606 GN=EPHA8 PE=1 SV=2
7	AFDB:P29323	0.450	0.432	0.000	1055	0.418	0.399	P29323.pdb.gz	EPHB2_HUMAN Ephrin type-B receptor 2 OS=Homo sapiens OX=9606 GN=EPHB2 PE=1 SV=5
8	AFDB:P54756	0.397	0.387	0.000	1037	0.473	0.460	P54756.pdb.gz	EPHA5_HUMAN Ephrin type-A receptor 5 OS=Homo sapiens OX=9606 GN=EPHA5 PE=1 SV=3
9	AFDB:P54759	0.546	0.551	0.000	998	0.526	0.531	P54759.pdb.gz	EPHA7_RAT Ephrin type-A receptor 7 OS=Rattus norvegicus OX=10116 GN=Epha7 PE=1 SV=1
10	AFDB:P54764	0.557	0.566	0.000	986	0.455	0.466	P54764.pdb.gz	EPHA4_HUMAN Ephrin type-A receptor 4 OS=Homo sapiens OX=9606 GN=EPHA4 PE=1 SV=1
11	PDB:4fl2A	0.249	0.443	3.938E-20	555	0.101	0.184	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
12	PDB:2h8hA	0.240	0.519	1.787E-18	445	0.104	0.236	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
13	PDB:1k9aB	0.235	0.523	5.694E-18	441	0.098	0.224	1k9aB.pdb.gz
14	PDB:4k2rA	0.239	0.426	8.794E-18	551	0.087	0.160	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
15	PDB:6s73A	0.229	0.789	1.591E-13	269	0.057	0.212	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
16	PDB:4btfA	0.218	0.501	3.282E-13	413	0.062	0.153	4btfA.pdb.gz
17	PDB:6b1uA	0.226	0.488	1.098E-12	442	0.070	0.161	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
18	PDB:7myjC	0.223	0.457	1.467E-12	465	0.076	0.166	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
19	PDB:8dksA	0.209	0.676	1.695E-12	283	0.060	0.212	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
20	PDB:5ufuA	0.216	0.551	1.779E-12	369	0.065	0.179	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4J1T8	891	1130	0.453	0.404	A0A0B4J1T8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA6 PE=1 SV=1
2	A0A0G2JY48	785	965	0.405	0.423	A0A0G2JY48_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=1 SV=2
3	A0A140VJJ0	947	983	0.461	0.473	A0A140VJJ0_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA3 PE=2 SV=1
4	A0A3B3IRY8	818	1055	0.410	0.391	A0A3B3IRY8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHB1 PE=1 SV=1
5	B1AKC9	804	946	0.404	0.430	B1AKC9_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHB2 PE=1 SV=1
6	B2B9B0	830	986	0.414	0.423	B2B9B0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=2 SV=1
7	C9JXA2	915	918	0.447	0.491	C9JXA2_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA3 PE=1 SV=1
8	D3ZDH4	674	977	0.391	0.403	D3ZDH4_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Epha1 PE=1 SV=1
9	D3ZZK3	882	949	0.445	0.473	D3ZZK3_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Epha4 PE=4 SV=2
10	F1MAJ0	824	987	0.412	0.420	F1MAJ0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=1 SV=4
11	O08644	642	1014	0.390	0.388	EPHB6_MOUSE Ephrin type-B receptor 6 OS=Mus musculus OX=10090 GN=Ephb6 PE=2 SV=4
12	O08680	933	984	0.460	0.472	EPHA3_RAT Ephrin type-A receptor 3 OS=Rattus norvegicus OX=10116 GN=Epha3 PE=2 SV=1
13	O09127	863	1004	0.454	0.456	EPHA8_MOUSE Ephrin type-A receptor 8 OS=Mus musculus OX=10090 GN=Epha8 PE=1 SV=2
14	O15197	635	1021	0.388	0.383	EPHB6_HUMAN Ephrin type-B receptor 6 OS=Homo sapiens OX=9606 GN=EPHB6 PE=1 SV=4
15	O73875	686	987	0.396	0.404	EPB4A_DANRE Ephrin type-B receptor 4a OS=Danio rerio OX=7955 GN=ephb4a PE=1 SV=3
16	O73878	680	976	0.386	0.399	EPB4B_DANRE Ephrin type-B receptor 4b OS=Danio rerio OX=7955 GN=ephb4b PE=1 SV=2
17	P09759	848	984	0.423	0.433	EPHB1_RAT Ephrin type-B receptor 1 OS=Rattus norvegicus OX=10116 GN=Ephb1 PE=1 SV=2
18	P21709	679	976	0.402	0.415	EPHA1_HUMAN Ephrin type-A receptor 1 OS=Homo sapiens OX=9606 GN=EPHA1 PE=1 SV=4
19	P28693	835	1004	0.416	0.417	EPHB2_CHICK Ephrin type-B receptor 2 OS=Gallus gallus OX=9031 GN=EPHB2 PE=1 SV=3
20	P29317	755	976	0.409	0.422	EPHA2_HUMAN Ephrin type-A receptor 2 OS=Homo sapiens OX=9606 GN=EPHA2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14575 EphA2_TM	1.9e-08	46.2	Ephrin type-A receptor 2 transmembrane domain
2	PF01404 Ephrin_lbd	3.7e-61	217.8	Ephrin receptor ligand binding domain
3	PF07699 Ephrin_rec_like	12	17.1	Tyrosine-protein kinase ephrin type A/B receptor-like
4	PF00041 fn3	1.3e-19	81.6	Fibronectin type III domain
5	PF09294 Interfer-bind	3.6e+02	12.9	Interferon-alpha/beta receptor, fibronectin type III
6	PF00069 Pkinase	3.2e-26	103.8	Protein kinase domain
7	PF07714 PK_Tyr_Ser-Thr	1.1e-71	252.7	Protein tyrosine and serine/threonine kinase
8	PF16656 Pur_ac_phosph_N	0.6	22.1	Purple acid Phosphatase, N-terminal domain
9	PF00536 SAM_1	7.8e-12	56.8	SAM domain (Sterile alpha motif)
10	PF07647 SAM_2	8.1e-11	53.2	SAM domain (Sterile alpha motif)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362139

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357392	0.957	Ephrin-A1
2	9606.ENSP00000414378	0.922	Ephrin-A4
3	9606.ENSP00000357393	0.895	Ephrin-A3
4	9606.ENSP00000204961	0.882	Ephrin-B1
5	9606.ENSP00000328777	0.875	Ephrin-A5
6	9606.ENSP00000226091	0.870	Ephrin-B3
7	9606.ENSP00000245323	0.863	Ephrin-B2
8	9606.ENSP00000215368	0.800	Ephrin-A2
9	9606.ENSP00000362153	0.704	Nucleolar GTP-binding protein 2
10	9606.ENSP00000389813	0.652	Acyl-CoA dehydrogenase family member 10
11	9606.ENSP00000481994	0.647	Ephrin type-B receptor 6
12	9606.ENSP00000350896	0.631	Ephrin type-B receptor 4
13	9606.ENSP00000381097	0.631	Ephrin type-B receptor 1
14	9606.ENSP00000332118	0.625	Ephrin type-B receptor 3
15	9606.ENSP00000260408	0.623	Disintegrin and metalloproteinase domain-containing protein 10
16	9606.ENSP00000363763	0.623	Ephrin type-B receptor 2
17	9606.ENSP00000426741	0.579	Ephrin-A3
18	9606.ENSP00000243344	0.572	Tetratricopeptide repeat protein 21B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005003	1.000	ephrin receptor activity
GO:0005005	0.590	transmembrane-ephrin receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.992	response to stimulus
GO:0009987	0.992	cellular process
GO:0050794	0.990	regulation of cellular process
GO:0051716	0.958	cellular response to stimulus
GO:0023052	0.878	signaling
GO:0007154	0.878	cell communication
GO:0032501	0.759	multicellular organismal process
GO:0007165	0.756	signal transduction
GO:0008152	0.699	metabolic process
GO:0071704	0.649	organic substance metabolic process
GO:0044238	0.640	primary metabolic process
GO:0007166	0.617	cell surface receptor signaling pathway
GO:0048856	0.563	anatomical structure development
GO:0048518	0.550	positive regulation of biological process
GO:0044237	0.544	cellular metabolic process
GO:0007167	0.505	enzyme-linked receptor protein signaling pathway
GO:0007169	0.485	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0006807	0.483	nitrogen compound metabolic process
GO:0048522	0.439	positive regulation of cellular process
GO:1901564	0.413	organonitrogen compound metabolic process
GO:0048013	0.413	ephrin receptor signaling pathway
GO:0016310	0.395	phosphorylation
GO:0006468	0.382	protein phosphorylation
GO:0007275	0.365	multicellular organism development
GO:0065009	0.362	regulation of molecular function
GO:0048731	0.332	system development
GO:0030155	0.304	regulation of cell adhesion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043226	0.699	organelle
GO:0005622	0.520	intracellular anatomical structure
GO:0043227	0.506	membrane-bounded organelle
GO:0005737	0.452	cytoplasm
GO:0005576	0.337	extracellular region
GO:0043229	0.320	intracellular organelle
GO:0005829	0.317	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.10.1	1.000	receptor protein-tyrosine kinase.

[back to server]