StarFunc result for job id Q5K4L6

User Input

>input (683 residues)
MAALLLLPLLLLLPLLLLKLHLWPQLRWLPADLAFAVRALCCKRALRARALAAAAADPEG
PEGGCSLAWRLAELAQQRAAHTFLIHGSRRFSYSEAERESNRAARAFLRALGWDWGPDGG
DSGEGSAGEGERAAPGAGDAAAGSGAEFAGGDGAARGGGAAAPLSPGATVALLLPAGPEF
LWLWFGLAKAGLRTAFVPTALRRGPLLHCLRSCGARALVLAPEFLESLEPDLPALRAMGL
HLWAAGPGTHPAGISDLLAEVSAEVDGPVPGYLSSPQSITDTCLYIFTSGTTGLPKAARI
SHLKILQCQGFYQLCGVHQEDVIYLALPLYHMSGSLLGIVGCMGIGATVVLKSKFSAGQF
WEDCQQHRVTVFQYIGELCRYLVNQPPSKAERGHKVRLAVGSGLRPDTWERFVRRFGPLQ
VLETYGLTEGNVATINYTGQRGAVGRASWLYKHIFPFSLIRYDVTTGEPIRDPQGHCMAT
SPGEPGLLVAPVSQQSPFLGYAGGPELAQGKLLKDVFRPGDVFFNTGDLLVCDDQGFLRF
HDRTGDTFRWKGENVATTEVAEVFEALDFLQEVNVYGVTVPGHEGRAGMAALVLRPPHAL
DLMQLYTHVSENLPPYARPRFLRLQESLATTETFKQQKVRMANEGFDPSTLSDPLYVLDQ
AVGAYLPLTTARYSALLAGNLRI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O88561	0.919	0.941	0.000	667	0.839	0.859	O88561.pdb.gz	S27A3_MOUSE Long-chain fatty acid transport protein 3 OS=Mus musculus OX=10090 GN=Slc27a3 PE=1 SV=2
2	AFDB:X6R3N0	0.974	0.823	0.000	811	1.000	0.842	X6R3N0.pdb.gz	X6R3N0_HUMAN Long-chain fatty acid transport protein 3 OS=Homo sapiens OX=9606 GN=SLC27A3 PE=1 SV=1
3	AFDB:E9Q9W4	0.844	0.928	1.338E-76	619	0.420	0.464	E9Q9W4.pdb.gz	S27A6_MOUSE Long-chain fatty acid transport protein 6 OS=Mus musculus OX=10090 GN=Slc27a6 PE=1 SV=1
4	AFDB:O35488	0.855	0.939	3.338E-75	620	0.391	0.431	O35488.pdb.gz	S27A2_MOUSE Long-chain fatty acid transport protein 2 OS=Mus musculus OX=10090 GN=Slc27a2 PE=1 SV=2
5	AFDB:O14975	0.677	0.742	1.574E-72	620	0.397	0.437	O14975.pdb.gz	S27A2_HUMAN Long-chain fatty acid transport protein 2 OS=Homo sapiens OX=9606 GN=SLC27A2 PE=1 SV=2
6	AFDB:Q4LDG0	0.841	0.833	2.453E-72	689	0.385	0.382	Q4LDG0.pdb.gz	S27A5_MOUSE Long-chain fatty acid transport protein 5 OS=Mus musculus OX=10090 GN=Slc27a5 PE=1 SV=2
7	AFDB:Q9Y2P4	0.675	0.741	2.897E-72	619	0.408	0.451	Q9Y2P4.pdb.gz	S27A6_HUMAN Long-chain fatty acid transport protein 6 OS=Homo sapiens OX=9606 GN=SLC27A6 PE=2 SV=1
8	AFDB:Q9ES38	0.672	0.665	2.191E-70	690	0.385	0.381	Q9ES38.pdb.gz	S27A5_RAT Long-chain fatty acid transport protein 5 OS=Rattus norvegicus OX=10116 GN=Slc27a5 PE=1 SV=1
9	AFDB:Q9Y2P5	0.672	0.666	2.378E-69	690	0.389	0.386	Q9Y2P5.pdb.gz	S27A5_HUMAN Long-chain fatty acid transport protein 5 OS=Homo sapiens OX=9606 GN=SLC27A5 PE=1 SV=1
10	AFDB:Q6PCB7	0.811	0.856	1.438E-65	646	0.354	0.375	Q6PCB7.pdb.gz	S27A1_HUMAN Long-chain fatty acid transport protein 1 OS=Homo sapiens OX=9606 GN=SLC27A1 PE=1 SV=1
11	PDB:3r44A	0.539	0.712	2.348E-32	502	0.168	0.229	3r44A.pdb.gz	The Mycobacterium tuberculosis Very-Long-Chain Fatty Acyl-CoA Synthetase: Structural Basis for Housing Lipid Substrates Longer than the Enzyme.
12	PDB:6q2mA	0.648	0.803	1.273E-30	544	0.146	0.184	6q2mA.pdb.gz	Mutagenesis and Structural Studies Reveal the Basis for the Activity and Stability Properties That Distinguish thePhotinusLuciferasesscintillansandpyralis.
13	PDB:5ie2A	0.616	0.818	2.767E-30	506	0.163	0.219	5ie2A.pdb.gz	Crystal Structures of Arabidopsis thaliana Oxalyl-CoA Synthetase Essential for Oxalate Degradation
14	PDB:5bsmA	0.640	0.814	3.268E-30	530	0.146	0.189	5bsmA.pdb.gz	Structural Basis for Specificity and Flexibility in a Plant 4-Coumarate:CoA Ligase.
15	PDB:7kydA	0.650	0.822	3.964E-29	534	0.142	0.182	7kydA.pdb.gz	FruitFire: a luciferase based on a fruit fly metabolic enzyme.
16	PDB:3b7wA	0.541	0.678	9.626E-29	537	0.170	0.216	3b7wA.pdb.gz	Structural snapshots for the conformation-dependent catalysis by human medium-chain acyl-coenzyme A synthetase ACSM2A.
17	PDB:1ry2A	0.649	0.717	1.270E-28	615	0.152	0.169	1ry2A.pdb.gz	Crystal structure of yeast acetyl-coenzyme A synthetase in complex with AMP
18	PDB:1ultA	0.549	0.687	7.492E-28	533	0.157	0.201	1ultA.pdb.gz
19	PDB:3rg2C	0.524	0.580	1.168E-27	613	0.151	0.168	3rg2C.pdb.gz	Structural and Functional Investigation of the Intermolecular Interaction between NRPS Adenylation and Carrier Protein Domains.
20	PDB:5ja2A	0.508	0.292	3.636E-26	1238	0.165	0.091	5ja2A.pdb.gz	Structures of a Nonribosomal Peptide Synthetase Module Bound to MbtH-like Proteins Support a Highly Dynamic Domain Architecture.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9Q9W4	0.0	547	619	0.388	0.428	S27A6_MOUSE Long-chain fatty acid transport protein 6 OS=Mus musculus OX=10090 GN=Slc27a6 PE=1 SV=1
2	H7BZH4	0.0	805	400	0.584	0.998	H7BZH4_HUMAN Long-chain fatty acid transport protein 3 (Fragment) OS=Homo sapiens OX=9606 GN=SLC27A3 PE=1 SV=1
3	O14975	0.0	530	620	0.359	0.395	S27A2_HUMAN Long-chain fatty acid transport protein 2 OS=Homo sapiens OX=9606 GN=SLC27A2 PE=1 SV=2
4	O88561	0.0	1075	667	0.810	0.829	S27A3_MOUSE Long-chain fatty acid transport protein 3 OS=Mus musculus OX=10090 GN=Slc27a3 PE=1 SV=2
5	Q5K4L6	0.0	1374	683	1.000	1.000	S27A3_HUMAN Long-chain fatty acid transport protein 3 OS=Homo sapiens OX=9606 GN=SLC27A3 PE=1 SV=4
6	Q9Y2P4	0.0	538	619	0.378	0.417	S27A6_HUMAN Long-chain fatty acid transport protein 6 OS=Homo sapiens OX=9606 GN=SLC27A6 PE=2 SV=1
7	X6R3N0	0.0	1372	811	1.000	0.842	X6R3N0_HUMAN Long-chain fatty acid transport protein 3 OS=Homo sapiens OX=9606 GN=SLC27A3 PE=1 SV=1
8	O35488	3.53e-177	520	620	0.347	0.382	S27A2_MOUSE Long-chain fatty acid transport protein 2 OS=Mus musculus OX=10090 GN=Slc27a2 PE=1 SV=2
9	P97524	3.35e-168	497	620	0.346	0.381	S27A2_RAT Long-chain fatty acid transport protein 2 OS=Rattus norvegicus OX=10116 GN=Slc27a2 PE=1 SV=1
10	Q4LDG0	1.03e-159	478	689	0.351	0.348	S27A5_MOUSE Long-chain fatty acid transport protein 5 OS=Mus musculus OX=10090 GN=Slc27a5 PE=1 SV=2
11	Q9Y2P5	1.23e-159	478	690	0.416	0.412	S27A5_HUMAN Long-chain fatty acid transport protein 5 OS=Homo sapiens OX=9606 GN=SLC27A5 PE=1 SV=1
12	Q9ES38	1.20e-156	470	690	0.343	0.339	S27A5_RAT Long-chain fatty acid transport protein 5 OS=Rattus norvegicus OX=10116 GN=Slc27a5 PE=1 SV=1
13	Q6PCB7	1.31e-136	417	646	0.341	0.361	S27A1_HUMAN Long-chain fatty acid transport protein 1 OS=Homo sapiens OX=9606 GN=SLC27A1 PE=1 SV=1
14	P97849	9.07e-134	410	646	0.332	0.351	S27A1_RAT Long-chain fatty acid transport protein 1 OS=Rattus norvegicus OX=10116 GN=Slc27a1 PE=2 SV=1
15	Q60714	1.41e-133	409	646	0.334	0.353	S27A1_MOUSE Long-chain fatty acid transport protein 1 OS=Mus musculus OX=10090 GN=Slc27a1 PE=1 SV=1
16	G3V7V3	9.28e-133	407	643	0.346	0.367	G3V7V3_RAT Solute carrier family 27 member 4 OS=Rattus norvegicus OX=10116 GN=Slc27a4 PE=1 SV=1
17	Q6P1M0	3.43e-132	405	643	0.341	0.362	S27A4_HUMAN Long-chain fatty acid transport protein 4 OS=Homo sapiens OX=9606 GN=SLC27A4 PE=1 SV=1
18	Q91VE0	1.64e-131	404	643	0.343	0.364	S27A4_MOUSE Long-chain fatty acid transport protein 4 OS=Mus musculus OX=10090 GN=Slc27a4 PE=1 SV=1
19	Q8SXR7	2.23e-124	387	687	0.318	0.316	Q8SXR7_DROME Fatty acid transport protein 3, isoform A OS=Drosophila melanogaster OX=7227 GN=Fatp3 PE=1 SV=1
20	Q9VKU1	3.96e-119	371	626	0.313	0.342	Q9VKU1_DROME Fatty acid transport protein 1, isoform A OS=Drosophila melanogaster OX=7227 GN=Fatp1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00501 AMP-binding	2.3e-58	209.5	AMP-binding enzyme
2	PF13193 AMP-binding_C	0.004	29.4	AMP-binding enzyme C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000485061

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000465589	0.781	Long-chain-fatty-acid--CoA ligase ACSBG2
2	9606.ENSP00000422607	0.678	Long-chain-fatty-acid--CoA ligase 1
3	9606.ENSP00000463574	0.641	Lysophosphatidic acid phosphatase type 6
4	9606.ENSP00000339787	0.615	Long-chain-fatty-acid--CoA ligase 4
5	9606.ENSP00000258873	0.545	Long-chain-fatty-acid--CoA ligase ACSBG1
6	9606.ENSP00000255389	0.539	Phosphatidylethanolamine N-methyltransferase
7	9606.ENSP00000465121	0.535	Zinc finger protein 226
8	9606.ENSP00000348429	0.532	Long-chain-fatty-acid--CoA ligase 5
9	9606.ENSP00000375836	0.508	Vigilin
10	9606.ENSP00000368566	0.505	Long-chain-fatty-acid--CoA ligase 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031957	0.999	very long-chain fatty acid-CoA ligase activity
GO:0004467	0.999	long-chain fatty acid-CoA ligase activity
GO:0005488	0.806	binding
GO:0005515	0.764	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044255	0.988	cellular lipid metabolic process
GO:0044281	0.985	small molecule metabolic process
GO:0006869	0.970	lipid transport
GO:0006082	0.965	organic acid metabolic process
GO:0032787	0.961	monocarboxylic acid metabolic process
GO:0006631	0.936	fatty acid metabolic process
GO:0001676	0.932	long-chain fatty acid metabolic process
GO:0015718	0.927	monocarboxylic acid transport
GO:0015908	0.536	fatty acid transport
GO:0006807	0.416	nitrogen compound metabolic process
GO:1901360	0.402	organic cyclic compound metabolic process
GO:0009058	0.388	biosynthetic process
GO:1901576	0.372	organic substance biosynthetic process
GO:1901564	0.369	organonitrogen compound metabolic process
GO:0006796	0.352	phosphate-containing compound metabolic process
GO:0019637	0.352	organophosphate metabolic process
GO:0008610	0.345	lipid biosynthetic process
GO:0009150	0.329	purine ribonucleotide metabolic process
GO:0044249	0.309	cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0016020	0.995	membrane
GO:0012505	0.994	endomembrane system
GO:0005739	0.990	mitochondrion
GO:0005783	0.968	endoplasmic reticulum
GO:0031090	0.886	organelle membrane
GO:0043233	0.587	organelle lumen
GO:0070013	0.498	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:15421	0.999	a long-chain fatty acid + ATP + CoA = a long-chain fatty acyl-CoA + AMP + diphosphate
EC:6.2.1.3	0.999	long-chain-fatty-acid--CoA ligase.

[back to server]