StarFunc result for job id Q5K651

User Input

>input (1589 residues)
MAKQLNLPENTDDWTKEDVNQWLESHKIDQKHREILTEQDVNGAVLKWLKKEHLVDMGIT
HGPAIQIEELFKELRKTAIEDSIQTSKMGKPSKNAPKDQTVSQKERRETSKQKQKGKENP
DMANPSAMSTTAKGSKSLKVELIEDKIDYTKERQPSIDLTCVSYPFDEFSNPYRYKLDFS
LQPETGPGNLIDPIHEFKAFTNTATATEEDVKMKFSNEVFRFASACMNSRTNGTIHFGVK
DKPHGKIVGIKVTNDTKEALINHFNLMINKYFEDHQVQQAKKCIREPRFVEVLLPNSTLS
DRFVIEVDIIPQFSECQYDYFQIKMQNYNNKIWEQSKKFSLFVRDGTSSKDITKNKVDFR
AFKADFKTLAESRKAAEEKFRAKTNKKEREGPKLVKLLTGNQDLLDNSYYEQYILVTNKC
HPDQTKHLDFLKEIKWFAVLEFDPESNINGVVKAYKESRVANLHFPSVYVEQKTTPNETI
STLNLYHQPSWIFCNGRLDLDSEKYKPFDPSSWQRERASDVRKLISFLTHEDIMPRGKFL
VVFLLLSSVDDPRDPLIETFCAFYQDLKGMENILCICVHPHIFQGWKDLLEARLIKHQDE
ISSQCISALSLEEINGTILKLKSVTQSSKRLLPSIGLSTVLLKKEEDIMTALEIICENEC
EGTLLEKDKNKFLEFKASKEEDFYRGGKVSWWNFYFSSESYSSPFVKRDKYERLEAMIQN
CADSSKPTSTKIIHLYHHPGCGGTTLAMHILWELRKKFRCAVLKNKTVDFSEIGEQVTSL
ITYGAMNRQEYVPVLLLVDDFEEQDNVYLLQYSIQTAIAKKYIRYEKPLVIILNCMRSQN
PEKSARIPDSIAVIQQLSPKEQRAFELKLKEIKEQHKNFEDFYSFMIMKTNFNKEYIENV
VRNILKGQNIFTKEAKLFSFLALLNSYVPDTTISLSQCEKFLGIGNKKAFWGTEKFEDKM
GTYSTILIKTEVIECGNYCGVRIIHSLIAEFSLEELKKSYHLNKSQIMLDMLTENLFFDT
GMGKSKFLQDMHTLLLTRHRDEHEGETGNWFSPFIEALHKDEGNEAVEAVLLESIHRFNP
NAFICQALARHFYIKKKDFGNALNWAKQAKIIEPDNSYISDTLGQVYKSKIRWWIEENGG
NGNISVDDLIALLDLAEHASSAFKESQQQSEDREYEVKERLYPKSKRRYDTYNIAGYQGE
IEVGLYTIQILQLIPFFDNKNELSKRYMVNFVSGSSDIPGDPNNEYKLALKNYIPYLTKL
KFSLKKSFDFFDEYFVLLKPRNNIKQNEEAKTRRKVAGYFKKYVDIFCLLEESQNNTGLG
SKFSEPLQVERCRRNLVALKADKFSGLLEYLIKSQEDAISTMKCIVNEYTFLLEQCTVKI
QSKEKLNFILANIILSCIQPTSRLVKPVEKLKDQLREVLQPIGLTYQFSEPYFLASLLFW
PENQQLDQHSEQMKEYAQALKNSFKGQYKHMHRTKQPIAYFFLGKGKRLERLVHKGKIDQ
CFKKTPDINSLWQSGDVWKEEKVQELLLRLQGRAENNCLYIEYGINEKITIPITPAFLGQ
LRSGRSIEKVSFYLGFSIGGPLAYDIEIV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5K651	1.000	1.000	0.000	1589	1.000	1.000	Q5K651.pdb.gz	SAMD9_HUMAN Sterile alpha motif domain-containing protein 9 OS=Homo sapiens OX=9606 GN=SAMD9 PE=1 SV=1
2	AFDB:Q69Z37	0.876	0.891	0.000	1561	0.539	0.549	Q69Z37.pdb.gz	SAM9L_MOUSE Sterile alpha motif domain-containing protein 9-like OS=Mus musculus OX=10090 GN=Samd9l PE=1 SV=2
3	AFDB:Q8IVG5	0.877	0.880	0.000	1584	0.602	0.604	Q8IVG5.pdb.gz	SAM9L_HUMAN Sterile alpha motif domain-containing protein 9-like OS=Homo sapiens OX=9606 GN=SAMD9L PE=1 SV=2
4	AFDB:O42668	0.073	0.098	3.389E-5	1039	0.069	0.105	O42668.pdb.gz	TPR1_SCHPO Tetratricopeptide repeat protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tpr1 PE=1 SV=1
5	AFDB:O14114	0.079	0.101	1.690E-4	1190	0.045	0.061	O14114.pdb.gz	ATD2_SCHPO ATPase histone chaperone abo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=abo1 PE=1 SV=1
6	AFDB:B5X0I6	0.072	0.094	2.425E-4	1091	0.065	0.094	B5X0I6.pdb.gz	VIP6_ARATH Protein CTR9 homolog OS=Arabidopsis thaliana OX=3702 GN=VIP6 PE=1 SV=1
7	PDB:7qdrB	0.081	0.096	3.624E-4	1212	0.054	0.071	7qdrB.pdb.gz
8	PDB:7ntfA	0.077	0.114	3.773E-4	918	0.035	0.060	7ntfA.pdb.gz
9	AFDB:Q62018	0.081	0.104	5.637E-4	1173	0.063	0.085	Q62018.pdb.gz	CTR9_MOUSE RNA polymerase-associated protein CTR9 homolog OS=Mus musculus OX=10090 GN=Ctr9 PE=1 SV=2
10	PDB:7dkhI	0.072	0.101	8.769E-4	914	0.058	0.101	7dkhI.pdb.gz
11	PDB:7zelA	0.069	0.124	1.116E-3	827	0.047	0.089	7zelA.pdb.gz	Mechanistic understanding of human SLFN11.
12	PDB:5dseA	0.087	0.197	1.162E-3	537	0.042	0.125	5dseA.pdb.gz
13	PDB:3j96F	0.110	0.194	1.259E-3	654	0.051	0.124	3j96F.pdb.gz
14	AFDB:Q99973	0.145	0.103	1.310E-3	2627	0.059	0.036	Q99973.pdb.gz	TEP1_HUMAN Telomerase protein component 1 OS=Homo sapiens OX=9606 GN=TEP1 PE=1 SV=2
15	PDB:2qbyA	0.093	0.304	1.420E-3	366	0.031	0.134	2qbyA.pdb.gz	Replication origin recognition and deformation by a heterodimeric archaeal Orc1 complex.
16	PDB:6bq1B	0.088	0.168	1.539E-3	728	0.063	0.137	6bq1B.pdb.gz	Architecture of the human PI4KIII alpha lipid kinase complex.
17	PDB:2qbyB	0.102	0.314	1.667E-3	368	0.023	0.098	2qbyB.pdb.gz	Replication origin recognition and deformation by a heterodimeric archaeal Orc1 complex.
18	PDB:6j5wA	0.118	0.205	1.881E-3	816	0.031	0.061	6j5wA.pdb.gz	Ligand-triggered allosteric ADP release primes a plant NLR complex.
19	AFDB:Q9C000	0.122	0.130	2.593E-3	1473	0.054	0.058	Q9C000.pdb.gz	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1 OS=Homo sapiens OX=9606 GN=NLRP1 PE=1 SV=1
20	AFDB:Q583S9	0.070	0.079	5.563E-3	1251	0.065	0.082	Q583S9.pdb.gz	Q583S9_TRYB2 ATP-dependent DEAH-box RNA helicase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.3D8.660 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C9JKF1	0.0	2662	1283	0.807	1.000	C9JKF1_HUMAN Sterile alpha motif domain containing 9 (Fragment) OS=Homo sapiens OX=9606 GN=SAMD9 PE=1 SV=1
2	Q5K651	0.0	3291	1589	1.000	1.000	SAMD9_HUMAN Sterile alpha motif domain-containing protein 9 OS=Homo sapiens OX=9606 GN=SAMD9 PE=1 SV=1
3	Q69Z37	0.0	1660	1561	0.544	0.554	SAM9L_MOUSE Sterile alpha motif domain-containing protein 9-like OS=Mus musculus OX=10090 GN=Samd9l PE=1 SV=2
4	Q8IVG5	0.0	1887	1584	0.607	0.609	SAM9L_HUMAN Sterile alpha motif domain-containing protein 9-like OS=Homo sapiens OX=9606 GN=SAMD9L PE=1 SV=2
5	Q9QX74	2.94e-05	51.6	1474	0.016	0.017	SHAN2_RAT SH3 and multiple ankyrin repeat domains protein 2 OS=Rattus norvegicus OX=10116 GN=Shank2 PE=1 SV=2
6	Q80Z38	3.10e-05	51.6	1476	0.016	0.017	SHAN2_MOUSE SH3 and multiple ankyrin repeat domains protein 2 OS=Mus musculus OX=10090 GN=Shank2 PE=1 SV=2
7	Q9UPX8	4.18e-05	51.2	1849	0.016	0.014	SHAN2_HUMAN SH3 and multiple ankyrin repeat domains protein 2 OS=Homo sapiens OX=9606 GN=SHANK2 PE=1 SV=4
8	Q4ACU6	0.004	44.3	1730	0.014	0.013	SHAN3_MOUSE SH3 and multiple ankyrin repeat domains protein 3 OS=Mus musculus OX=10090 GN=Shank3 PE=1 SV=3
9	Q9JLU4	0.004	44.3	1740	0.014	0.013	SHAN3_RAT SH3 and multiple ankyrin repeat domains protein 3 OS=Rattus norvegicus OX=10116 GN=Shank3 PE=1 SV=3
10	Q9BYB0	0.010	43.1	1731	0.014	0.013	SHAN3_HUMAN SH3 and multiple ankyrin repeat domains protein 3 OS=Homo sapiens OX=9606 GN=SHANK3 PE=1 SV=3
11	Q96NU1	0.045	40.8	681	0.013	0.029	SAM11_HUMAN Sterile alpha motif domain-containing protein 11 OS=Homo sapiens OX=9606 GN=SAMD11 PE=1 SV=3
12	Q9WV48	0.089	40.0	2167	0.012	0.009	SHAN1_RAT SH3 and multiple ankyrin repeat domains protein 1 OS=Rattus norvegicus OX=10116 GN=Shank1 PE=1 SV=1
13	D3YZU1	0.092	40.0	2167	0.012	0.009	SHAN1_MOUSE SH3 and multiple ankyrin repeat domains protein 1 OS=Mus musculus OX=10090 GN=Shank1 PE=1 SV=1
14	Q1RNF8	0.094	39.7	542	0.012	0.035	SAM11_MOUSE Sterile alpha motif domain-containing protein 11 OS=Mus musculus OX=10090 GN=Samd11 PE=2 SV=1
15	H9KV90	0.13	39.7	2169	0.012	0.009	H9KV90_HUMAN SH3 and multiple ankyrin repeat domains 1 OS=Homo sapiens OX=9606 GN=SHANK1 PE=1 SV=1
16	Q9Y566	0.13	39.7	2161	0.012	0.009	SHAN1_HUMAN SH3 and multiple ankyrin repeat domains protein 1 OS=Homo sapiens OX=9606 GN=SHANK1 PE=1 SV=2
17	B3KPJ4	0.19	38.5	464	0.014	0.047	B3KPJ4_HUMAN cDNA FLJ31867 fis, clone NT2RP7001856, highly similar to Polyhomeotic-like protein 2 OS=Homo sapiens OX=9606 PE=1 SV=1
18	Q7Z3H4	0.20	38.5	446	0.013	0.045	SAMD7_HUMAN Sterile alpha motif domain-containing protein 7 OS=Homo sapiens OX=9606 GN=SAMD7 PE=1 SV=1
19	Q64028	0.25	38.5	1010	0.015	0.024	PHC1_MOUSE Polyhomeotic-like protein 1 OS=Mus musculus OX=10090 GN=Phc1 PE=1 SV=3
20	P78364	0.39	37.7	1004	0.015	0.024	PHC1_HUMAN Polyhomeotic-like protein 1 OS=Homo sapiens OX=9606 GN=PHC1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	1.4e+02	14.2	AAA ATPase domain
2	PF10281 Ish1	4.3e+02	12.6	Putative nuclear envelope organisation protein
3	PF00536 SAM_1	0.0021	29.8	SAM domain (Sterile alpha motif)
4	PF07647 SAM_2	0.00082	30.7	SAM domain (Sterile alpha motif)
5	PF02198 SAM_PNT	1.5	20.2	Sterile alpha motif (SAM)/Pointed domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000369292

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378857	0.836	WD repeat-containing protein 6
2	9606.ENSP00000377344	0.830	Probable ATP-dependent RNA helicase DDX60
3	9606.ENSP00000390204	0.815	HEPACAM family member 2
4	9606.ENSP00000359783	0.805	Interferon-induced protein 44
5	9606.ENSP00000326247	0.800	Sterile alpha motif domain-containing protein 9-like
6	9606.ENSP00000360869	0.794	Interferon-induced protein with tetratricopeptide repeats 1
7	9606.ENSP00000360883	0.777	Interferon-induced protein with tetratricopeptide repeats 3
8	9606.ENSP00000263642	0.774	Interferon-induced helicase C domain-containing protein 1
9	9606.ENSP00000371471	0.766	Radical S-adenosyl methionine domain-containing protein 2
10	9606.ENSP00000307666	0.760	Syndetin
11	9606.ENSP00000360891	0.741	Interferon-induced protein with tetratricopeptide repeats 2
12	9606.ENSP00000369213	0.741	Probable ATP-dependent RNA helicase DDX58
13	9606.ENSP00000317955	0.730	Early endosome antigen 1
14	9606.ENSP00000342278	0.705	2'-5'-oligoadenylate synthase 2
15	9606.ENSP00000361120	0.693	Ral guanine nucleotide dissociation stimulator
16	9606.ENSP00000352561	0.670	Calcitonin receptor
17	9606.ENSP00000333657	0.665	Interferon-induced GTP-binding protein Mx2
18	9606.ENSP00000215794	0.662	Ubl carboxyl-terminal hydrolase 18
19	9606.ENSP00000381601	0.635	Interferon-induced GTP-binding protein Mx1
20	9606.ENSP00000262461	0.619	Solute carrier family 12 member 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0051179	0.833	localization
GO:0006906	0.812	vesicle fusion
GO:0065007	0.788	biological regulation
GO:0050789	0.756	regulation of biological process
GO:0050794	0.409	regulation of cellular process
GO:0050896	0.379	response to stimulus
GO:0019222	0.325	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005829	0.999	cytosol
GO:0005634	0.742	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]