StarFunc result for job id Q5KSL6

User Input

>input (1271 residues)
MDRGAAAAQGTAPPQDGEQPAESPEPPPPWPPPPPPPAPPPAPPLLSEASPEPIPEPCPE
LAPGPCPEATSESATELYTEPTPEPATEPASEPAPEPATEPAPEPATEPAPEPAPEPATE
SAPEPTPEPALESVPEPAPELTPEVAPELAPEPTPEPVTELAPEFCPEAAPEFRPSPAPC
LLQCPVDTRERGLKTSPSPSPSPSPRTPMSWSRIKKILKEGPMLKNCNSFKRWKLRYFLV
QGQKLYFAHHPAFAHFETIDLSQATVAESSCRNLCHSFCVITPQRKITLAAPNRKDMEEW
INIIKTIQQGEIYKIPAAENNPFLVGMHCWYSSYSHRTQHCNVCRESIPALSRDAIICEV
CKVKSHRLCALRASKDCKWNTLSITDDLLLPADEVNMPHQWVEGNMPVSSQCAVCHESCG
SYQRLQDFRCLWCNSTVHDDCRRRFSKECCFRSHRSSVIPPTALSDPKGDGQLVVSSDFW
NLDWSSACSCPLLIFINSKSGDHQGIVFLRKFKQYLNPSQVFDLLKGGPEAGLSMFKNFA
RFRILVCGGDGSVSWVLSLIDAFGLHEKCQLAVIPLGTGNDLARVLGWGAFWNKSKSPLD
ILNRVEQASVRILDRWSVMIRETPRQTPLLKGQVEMDVPRFEAAAIQHLESAATELNKIL
KAKYPTEMIIATRFLCSAVEDFVVDIVKAWGQIKQNNTAIVSVILKSDLMYDRLSVLIDV
LAEEAAATSAEKSATEYADSSKADRKPFIPQIDHIAKCKLELATKAQSLQKSLKLIIFQV
EQALDEESRQTISVKNFSSTFFLEDDPEDINQTSPRRRSRRGTLSSISSLKSEDLDNLNL
DHLHFTPESIRFKEKCVMNNYFGIGLDAKISLDFNTRRDEHPGQYNSRLKNKMWYGLLGT
KELLQRSYRKLEERVHLECDGETISLPNLQGIVVLNITSYAGGINFWGSNTATTEYEAPA
IDDGKLEVVAIFGSVQMAMSRIINLHHHRIAQCHEVMITIDGEEGIPVQVDGEAWIQRPG
LIKIRYKNAAQMLTRDRDFENSMKMWEYKHTEIQAAPQPQLDFQDSQESLSDEEYAQMQH
LARLAENLISKLNDLSKIHQHVSVLMGSVNASANILNDIFYGQDSGNEMGAASCIPIETL
SRNDAVDVTFSLKGLYDDTTAFLDEKLLRSAEDETALQSALDAMNKEFKKLSEIDWMNPI
FVPEEKSSDTDSRSLRLKIKFPKLGKKKVEEERKPKSGQSVQSFIGNLWHRRHREDEAEG
DDPLTPSRSQL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5KSL6	1.000	1.000	0.000	1271	1.000	1.000	Q5KSL6.pdb.gz	DGKK_HUMAN Diacylglycerol kinase kappa OS=Homo sapiens OX=9606 GN=DGKK PE=1 SV=1
2	AFDB:E9PUQ8	0.482	0.501	1.131E-89	1220	0.356	0.371	E9PUQ8.pdb.gz	DGKD_MOUSE Diacylglycerol kinase delta OS=Mus musculus OX=10090 GN=Dgkd PE=1 SV=1
3	AFDB:Q86XP1	0.466	0.484	2.229E-85	1220	0.353	0.368	Q86XP1.pdb.gz	DGKH_HUMAN Diacylglycerol kinase eta OS=Homo sapiens OX=9606 GN=DGKH PE=1 SV=1
4	AFDB:Q9Y4G2	0.075	0.090	2.468E-5	1056	0.046	0.056	Q9Y4G2.pdb.gz	PKHM1_HUMAN Pleckstrin homology domain-containing family M member 1 OS=Homo sapiens OX=9606 GN=PLEKHM1 PE=1 SV=3
5	PDB:4l02A	0.112	0.353	2.831E-5	360	0.017	0.061	4l02A.pdb.gz	Structure guided design of a series of sphingosine kinase (SphK) inhibitors.
6	AFDB:A0A140LH27	0.084	0.065	4.818E-5	1664	0.054	0.041	A0A140LH27.pdb.gz	A0A140LH27_DANRE Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 isoform X1 OS=Danio rerio OX=7955 GN=arap3 PE=4 SV=1
7	AFDB:Q8IVE3	0.072	0.062	6.732E-5	1493	0.046	0.040	Q8IVE3.pdb.gz	PKHH2_HUMAN Pleckstrin homology domain-containing family H member 2 OS=Homo sapiens OX=9606 GN=PLEKHH2 PE=1 SV=2
8	PDB:3ljuX	0.068	0.222	1.131E-4	373	0.019	0.064	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
9	AFDB:P34288	0.073	0.059	1.139E-4	1605	0.036	0.029	P34288.pdb.gz	PAC1_CAEEL GTPase-activating protein pac-1 OS=Caenorhabditis elegans OX=6239 GN=pac-1 PE=1 SV=4
10	PDB:1u0tB	0.088	0.348	1.581E-4	276	0.017	0.080	1u0tB.pdb.gz
11	PDB:2bonB	0.159	0.652	3.236E-4	265	0.043	0.208	2bonB.pdb.gz	Crystal Structure of Yegs, a Homologue to the Mammalian Diacylglycerol Kinases, Reveals a Novel Regulatory Metal Binding Site.
12	PDB:6u3eA	0.069	0.214	3.236E-4	397	0.018	0.058	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
13	PDB:2bonA	0.091	0.348	4.311E-4	287	0.021	0.094	2bonA.pdb.gz	Crystal Structure of Yegs, a Homologue to the Mammalian Diacylglycerol Kinases, Reveals a Novel Regulatory Metal Binding Site.
14	PDB:6bbpA	0.067	0.160	4.521E-4	520	0.018	0.044	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
15	AFDB:Q5T5U3	0.072	0.048	4.550E-4	1958	0.042	0.028	Q5T5U3.pdb.gz	RHG21_HUMAN Rho GTPase-activating protein 21 OS=Homo sapiens OX=9606 GN=ARHGAP21 PE=1 SV=2
16	AFDB:Q54W22	0.076	0.122	4.773E-4	741	0.038	0.065	Q54W22.pdb.gz	Q54W22_DICDI PH domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0280015 PE=4 SV=1
17	PDB:2qv7A	0.170	0.618	4.975E-4	303	0.043	0.182	2qv7A.pdb.gz	Analysis of the Staphylococcus aureus DgkB Structure Reveals a Common Catalytic Mechanism for the Soluble Diacylglycerol Kinases.
18	PDB:6hhgA	0.070	0.222	6.022E-4	386	0.020	0.065	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
19	AFDB:Q13009	0.073	0.060	6.668E-4	1591	0.037	0.030	Q13009.pdb.gz	TIAM1_HUMAN Rho guanine nucleotide exchange factor TIAM1 OS=Homo sapiens OX=9606 GN=TIAM1 PE=1 SV=2
20	PDB:4mk0A	0.071	0.140	1.723E-3	631	0.014	0.029	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3YXJ0	0.0	786	1211	0.357	0.375	DGKH_MOUSE Diacylglycerol kinase eta OS=Mus musculus OX=10090 GN=Dgkh PE=1 SV=2
2	E9PUQ8	0.0	779	1220	0.352	0.366	DGKD_MOUSE Diacylglycerol kinase delta OS=Mus musculus OX=10090 GN=Dgkd PE=1 SV=1
3	Q5KSL6	0.0	2627	1271	1.000	1.000	DGKK_HUMAN Diacylglycerol kinase kappa OS=Homo sapiens OX=9606 GN=DGKK PE=1 SV=1
4	Q16760	5.35e-153	494	1214	0.207	0.217	DGKD_HUMAN Diacylglycerol kinase delta OS=Homo sapiens OX=9606 GN=DGKD PE=1 SV=4
5	Q64398	1.17e-145	473	1154	0.194	0.214	DGKH_MESAU Diacylglycerol kinase eta OS=Mesocricetus auratus OX=10036 GN=DGKH PE=1 SV=1
6	Q86XP1	2.31e-144	471	1220	0.185	0.193	DGKH_HUMAN Diacylglycerol kinase eta OS=Homo sapiens OX=9606 GN=DGKH PE=1 SV=1
7	Q01583	9.25e-57	218	1211	0.086	0.090	DGK1_DROME Diacylglycerol kinase 1 OS=Drosophila melanogaster OX=7227 GN=Dgk PE=2 SV=5
8	P23743	3.06e-49	190	735	0.094	0.162	DGKA_HUMAN Diacylglycerol kinase alpha OS=Homo sapiens OX=9606 GN=DGKA PE=1 SV=3
9	Q91WG7	2.37e-48	188	788	0.096	0.155	DGKG_MOUSE Diacylglycerol kinase gamma OS=Mus musculus OX=10090 GN=Dgkg PE=1 SV=1
10	Q6NS52	4.39e-48	187	802	0.089	0.141	DGKB_MOUSE Diacylglycerol kinase beta OS=Mus musculus OX=10090 GN=Dgkb PE=1 SV=2
11	Q9Y6T7	1.43e-47	186	804	0.088	0.139	DGKB_HUMAN Diacylglycerol kinase beta OS=Homo sapiens OX=9606 GN=DGKB PE=1 SV=2
12	P49621	1.66e-47	186	801	0.090	0.144	DGKB_RAT Diacylglycerol kinase beta OS=Rattus norvegicus OX=10116 GN=Dgkb PE=1 SV=1
13	P20192	1.78e-47	185	734	0.092	0.159	DGKA_PIG Diacylglycerol kinase alpha OS=Sus scrofa OX=9823 GN=DGKA PE=1 SV=1
14	Q9R1C6	3.01e-46	178	564	0.088	0.199	DGKE_MOUSE Diacylglycerol kinase epsilon OS=Mus musculus OX=10090 GN=Dgke PE=1 SV=1
15	P49620	3.41e-46	181	788	0.088	0.142	DGKG_RAT Diacylglycerol kinase gamma OS=Rattus norvegicus OX=10116 GN=Dgkg PE=1 SV=1
16	P49619	5.52e-46	181	791	0.087	0.139	DGKG_HUMAN Diacylglycerol kinase gamma OS=Homo sapiens OX=9606 GN=DGKG PE=1 SV=3
17	O88673	1.03e-45	179	730	0.090	0.158	DGKA_MOUSE Diacylglycerol kinase alpha OS=Mus musculus OX=10090 GN=Dgka PE=1 SV=2
18	I3L112	2.27e-45	172	456	0.083	0.232	I3L112_HUMAN Diacylglycerol kinase (Fragment) OS=Homo sapiens OX=9606 GN=DGKE PE=1 SV=1
19	P51556	3.15e-45	177	727	0.090	0.158	DGKA_RAT Diacylglycerol kinase alpha OS=Rattus norvegicus OX=10116 GN=Dgka PE=1 SV=1
20	A1L4Q0	7.55e-45	174	567	0.083	0.187	A1L4Q0_HUMAN Diacylglycerol kinase OS=Homo sapiens OX=9606 GN=DGKE PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00130 C1_1	6.2e-06	37.3	Phorbol esters/diacylglycerol binding domain (C1 domain)
2	PF03107 C1_2	8.1e+02	11.8	C1 domain
3	PF00609 DAGK_acc	2.3e-45	166.3	Diacylglycerol kinase accessory domain
4	PF00781 DAGK_cat	2e-20	84.1	Diacylglycerol kinase catalytic domain
5	PF00169 PH	2.6e-09	48.9	PH domain
6	PF14593 PH_3	1.8e+02	13.5	PH domain
7	PF14446 Prok-RING_1	14	17.0	Prokaryotic RING finger family 1
8	PF19279 YegS_C	3.2e+02	12.5	YegS C-terminal NAD kinase beta sandwich-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000477515

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000295887	0.722	Phosphatidate cytidylyltransferase 1
2	9606.ENSP00000419879	0.722	Phosphatidate cytidylyltransferase 2
3	9606.ENSP00000367762	0.703	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4
4	9606.ENSP00000387050	0.691	Phospholipase D3
5	9606.ENSP00000263088	0.681	Phospholipase D2
6	9606.ENSP00000302177	0.673	Lysophospholipid acyltransferase 2
7	9606.ENSP00000244007	0.669	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
8	9606.ENSP00000482457	0.669	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
9	9606.ENSP00000376372	0.667	Phospholipase D family member 4
10	9606.ENSP00000358223	0.666	Pancreatic lipase
11	9606.ENSP00000433933	0.666	Inactive pancreatic lipase-related protein 1
12	9606.ENSP00000260402	0.665	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2
13	9606.ENSP00000338185	0.665	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1
14	9606.ENSP00000443631	0.665	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3
15	9606.ENSP00000365777	0.660	Methylenetetrahydrofolate reductase
16	9606.ENSP00000266505	0.658	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1
17	9606.ENSP00000360431	0.658	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1
18	9606.ENSP00000388631	0.658	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4
19	9606.ENSP00000430344	0.658	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1
20	9606.ENSP00000479636	0.658	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004143	1.000	diacylglycerol kinase activity
GO:0005488	0.936	binding
GO:0005515	0.923	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.991	cellular metabolic process
GO:0071704	0.988	organic substance metabolic process
GO:0044238	0.987	primary metabolic process
GO:0006638	0.978	neutral lipid metabolic process
GO:0065007	0.975	biological regulation
GO:0050789	0.972	regulation of biological process
GO:0006639	0.967	acylglycerol metabolic process
GO:0023052	0.963	signaling
GO:0007154	0.961	cell communication
GO:0050794	0.960	regulation of cellular process
GO:0032501	0.958	multicellular organismal process
GO:0030168	0.929	platelet activation
GO:0007165	0.826	signal transduction
GO:0006796	0.455	phosphate-containing compound metabolic process
GO:0046339	0.391	diacylglycerol metabolic process
GO:0006650	0.379	glycerophospholipid metabolic process
GO:0045017	0.372	glycerolipid biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0005622	0.966	intracellular anatomical structure
GO:0005737	0.961	cytoplasm
GO:0012505	0.853	endomembrane system
GO:0043231	0.837	intracellular membrane-bounded organelle
GO:0005829	0.768	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10272	1.000	a 1,2-diacyl-sn-glycerol + ATP = a 1,2-diacyl-sn-glycero-3-phosphate + ADP + H(+)
EC:2.7.1.107	1.000	diacylglycerol kinase (ATP).

[back to server]