StarFunc result for job id Q5M7Z0

User Input

>input (435 residues)
MPLFLLSLPTPPSASGHERRQRPEAKTSGSEKKYLRAMQANRSQLHSPPGTGSSEDASTP
QCVHTRLTGEGSCPHSGDVHIQINSIPKECAENASSRNIRSGVHSCAHGCVHSRLRGHSH
SEARLTDDTAAESGDHGSSSFSEFRYLFKWLQKSLPYILILSVKLVMQHITGISLGIGLL
TTFMYANKSIVNQVFLRERSSKIQCAWLLVFLAGSSVLLYYTFHSQSLYYSLIFLNPTLD
HLSFWEVFWIVGITDFILKFFFMGLKCLILLVPSFIMPFKSKGYWYMLLEELCQYYRTFV
PIPVWFRYLISYGEFGNVTRWSLGILLALLYLILKLLEFFGHLRTFRQVLRIFFTQPSYG
VAASKRQCSDVDDICSICQAEFQKPILLICQHIFCEECMTLWFNREKTCPLCRTVISDHI
NKWKDGATSSHLQIY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5M7Z0	1.000	1.000	7.479E-55	435	1.000	1.000	Q5M7Z0.pdb.gz	RNFT1_HUMAN E3 ubiquitin-protein ligase RNFT1 OS=Homo sapiens OX=9606 GN=RNFT1 PE=1 SV=2
2	AFDB:Q8VZL4	0.211	0.190	3.066E-3	497	0.101	0.089	Q8VZL4.pdb.gz	MSL1_ARATH Mechanosensitive ion channel protein 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MSL1 PE=1 SV=1
3	AFDB:O60067	0.127	0.092	6.353E-2	649	0.122	0.082	O60067.pdb.gz	TAPT1_SCHPO Endoplasmic reticulum membrane protein 65 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC13G1.05 PE=1 SV=1
4	AFDB:Q54RN4	0.095	0.082	1.037E-1	532	0.113	0.092	Q54RN4.pdb.gz	Q54RN4_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0283015 PE=4 SV=1
5	AFDB:Q8I6Z7	0.146	0.071	1.296E-1	1139	0.094	0.036	Q8I6Z7.pdb.gz	PDEB_PLAF7 Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase beta OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PDEbeta PE=1 SV=1
6	AFDB:Q4VY51	0.117	0.075	1.936E-1	894	0.108	0.053	Q4VY51.pdb.gz	SYM8_PEA Probable ion channel SYM8 OS=Pisum sativum OX=3888 GN=SYM8 PE=1 SV=3
7	AFDB:Q9SHU7	0.107	0.136	3.614E-1	296	0.097	0.142	Q9SHU7.pdb.gz	TIC21_ARATH Protein TIC 21, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TIC21 PE=1 SV=1
8	PDB:5dkaA	0.098	0.411	4.278E-1	96	0.037	0.167	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
9	AFDB:Q9ZTZ7	0.114	0.052	4.320E-1	1193	0.113	0.041	Q9ZTZ7.pdb.gz	KEA1_ARATH K(+) efflux antiporter 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=KEA1 PE=1 SV=2
10	AFDB:A0A0R4IVR8	0.153	0.153	4.517E-1	434	0.120	0.120	A0A0R4IVR8.pdb.gz
11	AFDB:Q8K1N2	0.121	0.053	5.902E-1	1249	0.106	0.037	Q8K1N2.pdb.gz	PHLB2_MOUSE Pleckstrin homology-like domain family B member 2 OS=Mus musculus OX=10090 GN=Phldb2 PE=1 SV=2
12	PDB:5gm6a	0.101	0.341	6.390E-1	123	0.028	0.098	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
13	PDB:7oikA	0.112	0.022	6.390E-1	4426	0.099	0.010	7oikA.pdb.gz	E3 ubiquitin ligase RNF213 employs a non-canonical zinc finger active site and is allosterically regulated by ATP
14	PDB:7ungA3	0.103	0.123	9.128E-1	333	0.080	0.105	7ungA3.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
15	PDB:4q25A	0.158	0.258	1.091	211	0.032	0.066	4q25A.pdb.gz
16	PDB:6tpiA	0.117	0.130	1.247	380	0.062	0.071	6tpiA.pdb.gz
17	PDB:6li3R	0.151	0.211	1.947	284	0.064	0.099	6li3R.pdb.gz
18	PDB:7f73A	0.145	0.201	2.129	293	0.062	0.092	7f73A.pdb.gz
19	PDB:3axjA	0.117	0.168	2.226	225	0.076	0.147	3axjA.pdb.gz
20	PDB:7o3vF	0.163	0.235	2.226	261	0.071	0.119	7o3vF.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5M7Z0	0.0	899	435	1.000	1.000	RNFT1_HUMAN E3 ubiquitin-protein ligase RNFT1 OS=Homo sapiens OX=9606 GN=RNFT1 PE=1 SV=2
2	Q2KHN1	3.18e-08	56.6	245	0.053	0.094	RN151_HUMAN RING finger protein 151 OS=Homo sapiens OX=9606 GN=RNF151 PE=1 SV=1
3	Q9CQ29	1.49e-06	51.6	239	0.044	0.079	RN151_MOUSE RING finger protein 151 OS=Mus musculus OX=10090 GN=Rnf151 PE=1 SV=1
4	O60683	2.56e-06	51.6	326	0.071	0.095	PEX10_HUMAN Peroxisome biogenesis factor 10 OS=Homo sapiens OX=9606 GN=PEX10 PE=1 SV=1
5	Q8BH75	3.14e-06	51.2	317	0.046	0.063	RNF41_MOUSE E3 ubiquitin-protein ligase NRDP1 OS=Mus musculus OX=10090 GN=Rnf41 PE=1 SV=1
6	Q9H4P4	3.19e-06	51.2	317	0.046	0.063	RNF41_HUMAN E3 ubiquitin-protein ligase NRDP1 OS=Homo sapiens OX=9606 GN=RNF41 PE=1 SV=2
7	Q9LW77	1.05e-05	50.1	492	0.044	0.039	HRD1A_ARATH ERAD-associated E3 ubiquitin-protein ligase HRD1A OS=Arabidopsis thaliana OX=3702 GN=HRD1A PE=2 SV=1
8	Q9DBY1	1.38e-05	49.7	612	0.048	0.034	SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=Mus musculus OX=10090 GN=Syvn1 PE=1 SV=3
9	Q6NPT7	1.60e-05	49.3	460	0.044	0.041	HRD1B_ARATH ERAD-associated E3 ubiquitin-protein ligase HRD1B OS=Arabidopsis thaliana OX=3702 GN=HRD1B PE=2 SV=1
10	Q9UKV5	1.73e-05	49.7	643	0.067	0.045	AMFR_HUMAN E3 ubiquitin-protein ligase AMFR OS=Homo sapiens OX=9606 GN=AMFR PE=1 SV=2
11	A0A0G2K437	1.88e-05	49.3	770	0.067	0.038	A0A0G2K437_RAT Autocrine motility factor receptor OS=Rattus norvegicus OX=10116 GN=Amfr PE=1 SV=2
12	Q8L9T5	2.15e-05	48.5	304	0.041	0.059	ATL2_ARATH RING-H2 finger protein ATL2 OS=Arabidopsis thaliana OX=3702 GN=ATL2 PE=2 SV=2
13	Q9R049	2.16e-05	49.3	643	0.067	0.045	AMFR_MOUSE E3 ubiquitin-protein ligase AMFR OS=Mus musculus OX=10090 GN=Amfr PE=1 SV=2
14	Q7ZW16	2.48e-05	48.5	318	0.044	0.060	RNF41_DANRE E3 ubiquitin-protein ligase NRDP1 OS=Danio rerio OX=7955 GN=rnf41 PE=2 SV=1
15	Q20798	2.61e-05	48.9	610	0.051	0.036	HRD1_CAEEL E3 ubiquitin-protein ligase hrd-1 OS=Caenorhabditis elegans OX=6239 GN=sel-11 PE=3 SV=1
16	Q86TM6	3.32e-05	48.5	617	0.046	0.032	SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=Homo sapiens OX=9606 GN=SYVN1 PE=1 SV=2
17	Q6PFU8	3.72e-05	48.5	620	0.064	0.045	Q6PFU8_DANRE Autocrine motility factor receptor OS=Danio rerio OX=7955 GN=amfr PE=2 SV=1
18	F1QB30	3.82e-05	48.5	620	0.064	0.045	F1QB30_DANRE Autocrine motility factor receptor a OS=Danio rerio OX=7955 GN=amfr PE=4 SV=1
19	Q9SYU4	7.30e-05	47.0	381	0.039	0.045	PEX10_ARATH Peroxisome biogenesis factor 10 OS=Arabidopsis thaliana OX=3702 GN=PEX10 PE=1 SV=1
20	P28284	9.29e-05	47.4	825	0.041	0.022	ICP0_HHV2H E3 ubiquitin-protein ligase ICP0 OS=Human herpesvirus 2 (strain HG52) OX=10315 GN=RL2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14447 Prok-RING_4	0.0018	29.4	Prokaryotic RING finger family 4
2	PF00097 zf-C3HC4	0.0022	29.1	Zinc finger, C3HC4 type (RING finger)
3	PF13923 zf-C3HC4_2	0.00083	30.4	Zinc finger, C3HC4 type (RING finger)
4	PF13920 zf-C3HC4_3	1.3e-06	39.5	Zinc finger, C3HC4 type (RING finger)
5	PF15227 zf-C3HC4_4	11	17.6	zinc finger of C3HC4-type, RING
6	PF12678 zf-rbx1	0.021	26.4	RING-H2 zinc finger domain
7	PF17120 zf-RING_16	39	15.3	RING/Ubox like zinc-binding domain
8	PF13639 zf-RING_2	2.7e-05	35.8	Ring finger domain
9	PF14634 zf-RING_5	0.0007	30.8	zinc-RING finger domain
10	PF14835 zf-RING_6	14	16.9	zf-RING of BARD1-type protein
11	PF13445 zf-RING_UBOX	0.0023	29.3	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000304670

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000269127	0.749	Uncharacterized protein C17orf64
2	9606.ENSP00000411250	0.673	Next to BRCA1 gene 1 protein
3	9606.ENSP00000359295	0.637	Protein Dr1
4	9606.ENSP00000375067	0.636	Breast carcinoma-amplified sequence 3
5	9606.ENSP00000312272	0.629	Protein yippee-like 2
6	9606.ENSP00000311219	0.619	Tripartite motif-containing protein 59
7	9606.ENSP00000414237	0.603	Integrator complex subunit 2
8	9606.ENSP00000184956	0.592	HEAT repeat-containing protein 6
9	9606.ENSP00000251241	0.568	Probable ATP-dependent RNA helicase DHX40
10	9606.ENSP00000083182	0.553	Amyloid protein-binding protein 2
11	9606.ENSP00000216420	0.537	Cell growth regulator with RING finger domain protein 1
12	9606.ENSP00000300896	0.523	Ubiquitin specific peptidase 32
13	9606.ENSP00000410157	0.523	Ankyrin repeat and BTB/POZ domain-containing protein 2
14	9606.ENSP00000320797	0.521	Tubulin delta chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043130	1.000	ubiquitin binding
GO:0061630	1.000	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.988	regulation of cellular process
GO:0071704	0.986	organic substance metabolic process
GO:0044238	0.986	primary metabolic process
GO:0006807	0.966	nitrogen compound metabolic process
GO:0070647	0.953	protein modification by small protein conjugation or removal
GO:0032446	0.937	protein modification by small protein conjugation
GO:0016567	0.933	protein ubiquitination
GO:0048518	0.919	positive regulation of biological process
GO:0051171	0.910	regulation of nitrogen compound metabolic process
GO:0060255	0.909	regulation of macromolecule metabolic process
GO:0080090	0.907	regulation of primary metabolic process
GO:1903050	0.900	regulation of proteolysis involved in protein catabolic process
GO:0042176	0.900	regulation of protein catabolic process
GO:0048522	0.896	positive regulation of cellular process
GO:1905897	0.885	regulation of response to endoplasmic reticulum stress
GO:0045862	0.831	positive regulation of proteolysis
GO:0009896	0.820	positive regulation of catabolic process
GO:0051865	0.744	protein autoubiquitination
GO:0009987	0.743	cellular process
GO:0061136	0.728	regulation of proteasomal protein catabolic process
GO:1903052	0.702	positive regulation of proteolysis involved in protein catabolic process
GO:1905898	0.698	positive regulation of response to endoplasmic reticulum stress
GO:0045732	0.695	positive regulation of protein catabolic process
GO:1901800	0.482	positive regulation of proteasomal protein catabolic process
GO:0050896	0.393	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	0.995	endoplasmic reticulum
GO:0016020	0.835	membrane
GO:0070013	0.383	intracellular organelle lumen
GO:0005634	0.329	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]