StarFunc result for job id Q5M9N0

User Input

>input (1113 residues)
MESKAWESNNEDLLSSSGVTSNGGSSSSFFVSSIRGTIIENTSSAGTLTQVPFFPKYEVE
LDSPRKIIPSPGKEHFERVLEEYSHQVKDLQRRLNESNELHEKQKFYLRQSVIDLQTKLQ
EMQMERDAMADIRRRESQSQEDLRNQLQNTVHELEAAKCLKEDMLKDSNTQIEQLRKMML
SHEGVLQEIRSILVDFEEASGKKICEHDSMSTLHFRSLGSAISKILRELDTEISYLKGRI
FPVEDQLEALKSESQNKIELLLQQHQDRIEQLISEHEVEITGLTEKASSARSQANSIQSQ
MEIIQEQARNQNSMYMRQLSDLESTVSQLRSELREAKRMYEDKTEELEKQLVLANSELTE
ARTERDQFSQESGNLDDQLQKLLADLHKREKELSLEKEQNKRLWDRDTGNSITIDHLRRE
LDNRNMEVQRLEALLKALKSECQGQMERQMAAIQGKNESLEKVSSLTAQLESTKEMLRKV
VEELTAKKMTLESSERTISDLTTSLQEKERAIEATNAEITKLRSRVDLKLQELQHLKNEG
DHLRNVQTECEALKLQMTEKDKVIEILRQQIENMTQLVGQHGRTAGAMQVEKAQLEKEIN
DRRMELKELKILKDKKDAKIRELEARVSDLELEKVKLVNAGSERLRAVKDIKQERDQLLN
EVKTSRSELNNLSEEYEVLKRNFRNKSEEMEMTTNKLKMQLKSAQSELEQTRNTLKSMEG
SDGHAMKVAMGMQKQITAKRGQIDALQSKIQFLEEAMTNANKEKHFLKEEKSKLSQELST
VATEKNKMAGELEVLRSQERRLKEKVTNMEVALDKASLQFAECQDIIQRQEQESVRLKLQ
HTLDIKELQGPGYTSNSSLKPRLLQPASVTRSHSNVPSSQSTASFLSHHSTKANTLKEDP
TRDLKQLLQELRSVINEEPAVSLSKTEEDGRTSLGALEDRVRDCITESSLRSDMCHRSNN
SLRDSTEGSKSSETLSREPVTLHAGDREDPSGCFTFTSAASPSVKNSASRSFNSSPKKSP
VHSLLTSSVEGSIGSTSQYRSAKPIHSSDSVKDSQSPPIETTGKTCRKLQNRLESLQTLV
EDLQLKNQAMSSMIRNQEKRIQKVKDQEKMLLK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5M9N0	1.000	1.000	0.000	1113	1.000	1.000	Q5M9N0.pdb.gz	CD158_HUMAN Coiled-coil domain-containing protein 158 OS=Homo sapiens OX=9606 GN=CCDC158 PE=1 SV=2
2	AFDB:M9PCR7	0.099	0.092	5.552E-7	1205	0.139	0.129	M9PCR7.pdb.gz	M9PCR7_DROME Liprin-alpha, isoform D OS=Drosophila melanogaster OX=7227 GN=Liprin-alpha PE=1 SV=1
3	AFDB:Q387K6	0.101	0.132	1.039E-6	821	0.131	0.178	Q387K6.pdb.gz	Q387K6_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0690 PE=4 SV=1
4	AFDB:Q2TAC2	0.122	0.143	3.417E-6	915	0.130	0.158	Q2TAC2.pdb.gz	CCD57_HUMAN Coiled-coil domain-containing protein 57 OS=Homo sapiens OX=9606 GN=CCDC57 PE=1 SV=3
5	AFDB:B8QI33	0.120	0.109	7.248E-6	1267	0.151	0.133	B8QI33.pdb.gz	B8QI33_MOUSE Liprin-alpha 1 OS=Mus musculus OX=10090 GN=Ppfia1 PE=2 SV=1
6	AFDB:Q8IR55	0.089	0.044	9.312E-6	2567	0.178	0.077	Q8IR55.pdb.gz	Q8IR55_DROME Mushroom body defect, isoform H OS=Drosophila melanogaster OX=7227 GN=mud PE=1 SV=3
7	AFDB:Q9SAF6	0.111	0.109	9.914E-6	1128	0.166	0.164	Q9SAF6.pdb.gz	CRWN2_ARATH Protein CROWDED NUCLEI 2 OS=Arabidopsis thaliana OX=3702 GN=CRWN2 PE=1 SV=1
8	AFDB:Q86V48	0.079	0.081	1.274E-5	1076	0.093	0.096	Q86V48.pdb.gz	LUZP1_HUMAN Leucine zipper protein 1 OS=Homo sapiens OX=9606 GN=LUZP1 PE=1 SV=2
9	AFDB:Q8R4U7	0.077	0.080	1.274E-5	1068	0.089	0.093	Q8R4U7.pdb.gz	LUZP1_MOUSE Leucine zipper protein 1 OS=Mus musculus OX=10090 GN=Luzp1 PE=1 SV=2
10	AFDB:Q5EE04	0.086	0.053	1.356E-5	1997	0.183	0.102	Q5EE04.pdb.gz	TPR_XENLA Nucleoprotein TPR (Fragment) OS=Xenopus laevis OX=8355 GN=tpr PE=1 SV=1
11	PDB:6c24C	0.039	0.224	3.634	148	0.022	0.162	6c24C.pdb.gz	Structures of human PRC2 with its cofactors AEBP2 and JARID2.
12	PDB:7r5jV0	0.044	0.154	5.293	273	0.040	0.161	7r5jV0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
13	PDB:5j9qB	0.035	0.266	7.240	79	0.014	0.203	5j9qB.pdb.gz	The NuA4 Core Complex Acetylates Nucleosomal Histone H4 through a Double Recognition Mechanism
14	PDB:5kodD	0.025	0.045	8.206	566	0.004	0.009	5kodD.pdb.gz	Arabidopsis thaliana GH3.5 acyl acid amido synthetase mediates metabolic crosstalk in auxin and salicylic acid homeostasis.
15	PDB:4v6xCR	0.051	0.264	9.903	189	0.015	0.090	4v6xCR.pdb.gz	Structures of the human and Drosophila 80S ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5M9N0	0.0	2246	1113	1.000	1.000	CD158_HUMAN Coiled-coil domain-containing protein 158 OS=Homo sapiens OX=9606 GN=CCDC158 PE=1 SV=2
2	Q2Q1W5	4.29e-11	70.1	3664	0.101	0.031	Q2Q1W5_DANRE Laminin alpha 5 OS=Danio rerio OX=7955 GN=wu:fb81a10 PE=1 SV=1
3	C1P640	1.04e-08	62.4	3683	0.064	0.019	C1P640_CAEEL Laminin-like protein epi-1 OS=Caenorhabditis elegans OX=6239 GN=epi-1 PE=1 SV=1
4	Q21313	1.07e-08	62.4	3672	0.064	0.019	EPI1_CAEEL Laminin-like protein epi-1 OS=Caenorhabditis elegans OX=6239 GN=epi-1 PE=1 SV=1
5	C1P641	1.08e-08	62.4	3663	0.064	0.019	C1P641_CAEEL Laminin-like protein epi-1 OS=Caenorhabditis elegans OX=6239 GN=epi-1 PE=1 SV=1
6	G5EEV6	1.10e-08	62.4	3704	0.064	0.019	G5EEV6_CAEEL Laminin alpha OS=Caenorhabditis elegans OX=6239 GN=epi-1 PE=1 SV=1
7	Q382P4	0.001	45.8	1299	0.085	0.073	Q382P4_TRYB2 IF rod domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.52.0008 PE=4 SV=1
8	A0A384MQX1	0.005	43.1	664	0.034	0.057	A0A384MQX1_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
9	P02545	0.005	43.1	664	0.034	0.057	LMNA_HUMAN Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA PE=1 SV=1
10	P48678	0.007	42.7	665	0.034	0.057	LMNA_MOUSE Prelamin-A/C OS=Mus musculus OX=10090 GN=Lmna PE=1 SV=2
11	P48679	0.007	42.7	665	0.034	0.057	LMNA_RAT Prelamin-A/C OS=Rattus norvegicus OX=10116 GN=Lmna PE=1 SV=1
12	Q4U0S2	0.010	42.7	1974	0.155	0.087	Q4U0S2_DANRE Myosin-11 OS=Danio rerio OX=7955 GN=myh11 PE=1 SV=1
13	J3QS22	0.015	42.0	783	0.061	0.087	J3QS22_HUMAN Sperm antigen with calponin homology and coiled-coil domains 1 (Fragment) OS=Homo sapiens OX=9606 GN=SPECC1 PE=1 SV=9
14	Q3BDU5	0.016	41.6	487	0.034	0.078	Q3BDU5_HUMAN Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA PE=1 SV=1
15	H2L0I2	0.017	42.0	2396	0.093	0.043	H2L0I2_CAEEL Lin-5 (Five) Interacting protein OS=Caenorhabditis elegans OX=6239 GN=lfi-1 PE=1 SV=1
16	Q9Y592	0.017	41.6	701	0.103	0.164	CEP83_HUMAN Centrosomal protein of 83 kDa OS=Homo sapiens OX=9606 GN=CEP83 PE=1 SV=3
17	Q5M775	0.018	41.6	1068	0.061	0.064	CYTSB_HUMAN Cytospin-B OS=Homo sapiens OX=9606 GN=SPECC1 PE=1 SV=1
18	H2L0I4	0.020	41.6	2392	0.093	0.043	H2L0I4_CAEEL Lin-5 OS=Caenorhabditis elegans OX=6239 GN=lfi-1 PE=1 SV=2
19	Q5SXY1	0.022	41.6	1067	0.065	0.067	CYTSB_MOUSE Cytospin-B OS=Mus musculus OX=10090 GN=Specc1 PE=1 SV=2
20	H2L0I3	0.026	41.2	2323	0.093	0.044	H2L0I3_CAEEL Lin-5 OS=Caenorhabditis elegans OX=6239 GN=lfi-1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15921 CCDC158	0	2418.6	Coiled-coil domain-containing protein 158
2	PF03858 Crust_neuro_H	2.2e+02	14.1	Crustacean neurohormone H
3	PF16888 DUF5082	20	16.9	Domain of unknown function (DUF5082)
4	PF00038 Filament	17	16.5	Intermediate filament protein
5	PF14662 KASH_CCD	7.1	18.0	Coiled-coil region of CCDC155 or KASH
6	PF13083 KH_4	87	14.4	KH domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000373566

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264883	0.601	Nucleoporin p54
2	9606.ENSP00000471549	0.573	Zinc finger protein 615
3	9606.ENSP00000296657	0.560	Ankyrin repeat domain-containing protein 33B
4	9606.ENSP00000422067	0.559	FAM47E-STBD1 readthrough
5	9606.ENSP00000442600	0.550	Dystroglycan
6	9606.ENSP00000409423	0.530	Protein FAM47E
7	9606.ENSP00000363064	0.524	Zinc finger protein 76
8	9606.ENSP00000295488	0.520	Helicase POLQ-like
9	9606.ENSP00000348596	0.502	Protein SDA1 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.490	structural molecule activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050789	0.966	regulation of biological process
GO:0050794	0.963	regulation of cellular process
GO:0071840	0.865	cellular component organization or biogenesis
GO:0016043	0.849	cellular component organization
GO:0007017	0.583	microtubule-based process
GO:0008152	0.474	metabolic process
GO:0006996	0.432	organelle organization
GO:0071704	0.422	organic substance metabolic process
GO:0043170	0.339	macromolecule metabolic process
GO:0006807	0.324	nitrogen compound metabolic process
GO:0048518	0.311	positive regulation of biological process
GO:0032501	0.309	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.998	membrane-bounded organelle
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0005856	0.988	cytoskeleton
GO:0043231	0.971	intracellular membrane-bounded organelle
GO:0005737	0.960	cytoplasm
GO:0032991	0.900	protein-containing complex
GO:0005634	0.833	nucleus
GO:0005813	0.831	centrosome
GO:0005829	0.663	cytosol
GO:0120025	0.333	plasma membrane bounded cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]