StarFunc result for job id Q5MIZ7

User Input

>input (849 residues)
MSDTRRRVKVYTLNEDRQWDDRGTGHVSSTYVEELKGMSLLVRAESDGSLLLESKINPNT
AYQKQQDTLIVWSEAENYDLALSFQEKAGCDEIWEKICQVQGKDPSVEVTQDLIDESEEE
RFEEMPETSHLIDLPTCELNKLEEIADLVTSVLSSPIRREKLALALENEGYIKKLLQLFQ
ACENLENTEGLHHLYEIIRGILFLNKATLFEVMFSDECIMDVVGCLEYDPALAQPKRHRE
FLTKTAKFKEVIPITDSELRQKIHQTYRVQYIQDIILPTPSVFEENFLSTLTSFIFFNKV
EIVSMLQEDEKFLSEVFAQLTDEATDDDKRRELVNFFKEFCAFSQTLQPQNRDAFFKTLA
KLGILPALEIVMGMDDLQVRSAATDIFSYLVEFSPSMVREFVMQEAQQSDDDILLINVVI
EQMICDTDPELGGAVQLMGLLRTLIDPENMLATTNKTEKSEFLNFFYNHCMHVLTAPLLT
NTSEDKCEKDFFLKHYRYSWSFICTPSHSHSHSTPSSSISQDNIVGSNKNNTICPDNYQT
AQLLALILELLTFCVEHHTYHIKNYIMNKDLLRRVLVLMNSKHTFLALCALRFMRRIIGL
KDEFYNRYITKGNLFEPVINALLDNGTRYNLLNSAVIELFEFIRVEDIKSLTAHIVENFY
KALESIEYVQTFKGLKTKYEQEKDRQNQKLNSVPSILRSNRFRRDAKALEEDEEMWFNED
EEEEGKAVVAPVEKPKPEDDFPDNYEKFMETKKAKESEDKENLPKRTSPGGFKFTFSHSA
SAANGTNSKSVVAQIPPATSNGSSSKTTNLPTSVTATKGSLVGLVDYPDDEEEDEEEESS
PRKRPRLGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5MIZ7	1.000	1.000	5.830E-104	849	1.000	1.000	Q5MIZ7.pdb.gz	P4R3B_HUMAN Serine/threonine-protein phosphatase 4 regulatory subunit 3B OS=Homo sapiens OX=9606 GN=PPP4R3B PE=1 SV=2
2	AFDB:Q922R5	0.794	0.821	2.923E-89	820	0.929	0.962	Q922R5.pdb.gz	P4R3B_MOUSE Serine/threonine-protein phosphatase 4 regulatory subunit 3B OS=Mus musculus OX=10090 GN=Ppp4r3b PE=1 SV=2
3	AFDB:Q6IN85	0.756	0.770	3.967E-75	833	0.703	0.717	Q6IN85.pdb.gz	P4R3A_HUMAN Serine/threonine-protein phosphatase 4 regulatory subunit 3A OS=Homo sapiens OX=9606 GN=PPP4R3A PE=1 SV=1
4	AFDB:Q9VFS5	0.632	0.550	7.602E-62	980	0.515	0.446	Q9VFS5.pdb.gz	PP4R3_DROME Serine/threonine-protein phosphatase 4 regulatory subunit 3 OS=Drosophila melanogaster OX=7227 GN=flfl PE=1 SV=4
5	AFDB:F4JC31	0.539	0.518	1.336E-39	886	0.304	0.291	F4JC31.pdb.gz	F4JC31_ARATH Binding protein OS=Arabidopsis thaliana OX=3702 GN=SMEK1 PE=1 SV=1
6	AFDB:Q54I18	0.542	0.446	2.600E-39	1046	0.280	0.228	Q54I18.pdb.gz	SMEK_DICDI Suppressor of Mek1 OS=Dictyostelium discoideum OX=44689 GN=smkA PE=1 SV=1
7	AFDB:Q9Y7J8	0.534	0.542	1.057E-34	836	0.274	0.279	Q9Y7J8.pdb.gz	YGL1_SCHPO Uncharacterized protein C216.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC216.01c PE=2 SV=3
8	AFDB:P40164	0.502	0.497	2.857E-27	858	0.213	0.211	P40164.pdb.gz	PP4R3_YEAST Serine/threonine-protein phosphatase 4 regulatory subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PSY2 PE=1 SV=1
9	AFDB:Q8C0Y0	0.198	0.194	5.432E-5	875	0.128	0.125	Q8C0Y0.pdb.gz	PP4R4_MOUSE Serine/threonine-protein phosphatase 4 regulatory subunit 4 OS=Mus musculus OX=10090 GN=Ppp4r4 PE=1 SV=2
10	AFDB:A2BID5	0.191	0.197	6.109E-5	813	0.086	0.090	A2BID5.pdb.gz	MELT_DANRE Ventricular zone-expressed PH domain-containing protein OS=Danio rerio OX=7955 GN=veph PE=2 SV=1
11	PDB:5tbkA	0.240	0.397	1.536E-4	417	0.078	0.158	5tbkA.pdb.gz
12	PDB:3m1iB	0.106	0.620	1.942E-4	131	0.026	0.168	3m1iB.pdb.gz	An allosteric mechanism to displace nuclear export cargo from CRM1 and RanGTP by RanBP1
13	PDB:7wttK	0.219	0.192	2.555E-4	1022	0.091	0.075	7wttK.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
14	PDB:1b3uA	0.143	0.172	4.088E-4	588	0.093	0.134	1b3uA.pdb.gz
15	PDB:2z6gA	0.271	0.372	4.781E-4	550	0.094	0.145	2z6gA.pdb.gz
16	PDB:3opbA	0.172	0.191	5.377E-4	747	0.073	0.083	3opbA.pdb.gz
17	PDB:4jlqA	0.182	0.184	5.592E-4	840	0.085	0.086	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
18	PDB:6kbnC	0.186	0.253	6.540E-4	504	0.075	0.127	6kbnC.pdb.gz	Quaternary structures of Vac8 differentially regulate the Cvt and PMN pathways.
19	PDB:1wa5B	0.228	0.369	1.088E-3	466	0.057	0.103	1wa5B.pdb.gz	Structural basis for the assembly of a nuclear export complex.
20	PDB:3tpoA	0.239	0.397	1.132E-3	438	0.074	0.144	3tpoA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H2KYN6	0.0	555	1085	0.349	0.273	H2KYN6_CAEEL Serine/threonine-protein phosphatase 4 regulatory subunit 3-like central domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=smk-1 PE=1 SV=1
2	Q5MIZ7	0.0	1758	849	1.000	1.000	P4R3B_HUMAN Serine/threonine-protein phosphatase 4 regulatory subunit 3B OS=Homo sapiens OX=9606 GN=PPP4R3B PE=1 SV=2
3	Q6IN85	0.0	1179	833	0.710	0.724	P4R3A_HUMAN Serine/threonine-protein phosphatase 4 regulatory subunit 3A OS=Homo sapiens OX=9606 GN=PPP4R3A PE=1 SV=1
4	Q6P2K6	0.0	1186	820	0.709	0.734	P4R3A_MOUSE Serine/threonine-protein phosphatase 4 regulatory subunit 3A OS=Mus musculus OX=10090 GN=Ppp4r3a PE=1 SV=1
5	Q922R5	0.0	1545	820	0.931	0.963	P4R3B_MOUSE Serine/threonine-protein phosphatase 4 regulatory subunit 3B OS=Mus musculus OX=10090 GN=Ppp4r3b PE=1 SV=2
6	Q9VFS5	0.0	868	980	0.488	0.422	PP4R3_DROME Serine/threonine-protein phosphatase 4 regulatory subunit 3 OS=Drosophila melanogaster OX=7227 GN=flfl PE=1 SV=4
7	H2KYN7	7.72e-165	502	849	0.310	0.310	H2KYN7_CAEEL Serine/threonine-protein phosphatase 4 regulatory subunit 3-like central domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=smk-1 PE=1 SV=1
8	F4JC31	3.59e-122	392	886	0.316	0.302	F4JC31_ARATH Binding protein OS=Arabidopsis thaliana OX=3702 GN=SMEK1 PE=1 SV=1
9	Q54I18	5.59e-117	382	1046	0.264	0.214	SMEK_DICDI Suppressor of Mek1 OS=Dictyostelium discoideum OX=44689 GN=smkA PE=1 SV=1
10	Q9Y7J8	1.86e-89	303	836	0.256	0.260	YGL1_SCHPO Uncharacterized protein C216.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC216.01c PE=2 SV=3
11	P40164	4.42e-33	139	858	0.139	0.138	PP4R3_YEAST Serine/threonine-protein phosphatase 4 regulatory subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PSY2 PE=1 SV=1
12	A0A1D8PCN8	3.31e-32	137	980	0.132	0.114	A0A1D8PCN8_CANAL Psy2p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PSY2 PE=4 SV=1
13	Q580Q3	1.00e-10	68.2	888	0.099	0.095	Q580Q3_TRYB2 Serine/threonine-protein phosphatase 4 regulatory subunit 3-like central domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.24M18.80 PE=4 SV=1
14	Q9Z1N3	0.056	39.7	2626	0.075	0.024	MYO9A_RAT Unconventional myosin-IXa OS=Rattus norvegicus OX=10116 GN=Myo9a PE=1 SV=1
15	Q8W586	0.54	36.2	379	0.039	0.087	QQT2_ARATH GPN-loop GTPase QQT2 OS=Arabidopsis thaliana OX=3702 GN=QQT2 PE=1 SV=1
16	A0A0B4K7J2	2.0	34.7	2718	0.028	0.009	RBP2_DROME E3 SUMO-protein ligase RanBP2 OS=Drosophila melanogaster OX=7227 GN=Nup358 PE=1 SV=1
17	Q6NK15	2.5	34.3	560	0.022	0.034	Q6NK15_CORDI Diphtheria toxin OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) OX=257309 GN=tox PE=1 SV=1
18	P00588	2.6	33.9	567	0.022	0.034	DTX_CORBE Diphtheria toxin OS=Corynephage beta OX=10703 PE=1 SV=2
19	Q6MG92	2.7	33.9	588	0.024	0.034	Q6MG92_RAT Butyrophilin-like 8 OS=Rattus norvegicus OX=10116 GN=Btnl8 PE=3 SV=1
20	Q585R2	4.5	33.5	1537	0.038	0.021	Q585R2_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.28P18.130 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08365 IGF2_C	28	16.3	Insulin-like growth factor II E-peptide
2	PF04802 PP4R3	1.8e-76	267.7	Phosphatase 4 regulatory subunit 3
3	PF00638 Ran_BP1	14	17.3	RanBP1 domain
4	PF00568 WH1	2.2	19.6	WH1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000483228

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000279387	0.999	Serine/threonine-protein phosphatase 4 catalytic subunit
2	9606.ENSP00000349124	0.992	Serine/threonine-protein phosphatase 4 regulatory subunit 2
3	9606.ENSP00000450864	0.921	Serine/threonine-protein phosphatase 4 regulatory subunit 3A
4	9606.ENSP00000357622	0.847	CREB-regulated transcription coactivator 2
5	9606.ENSP00000372023	0.796	Serine/threonine-protein kinase Chk2
6	9606.ENSP00000343741	0.795	Serine/threonine-protein kinase ATR
7	9606.ENSP00000383402	0.782	Serine/threonine-protein phosphatase 4 regulatory subunit 1
8	9606.ENSP00000377036	0.765	Serine/threonine-protein phosphatase 2A activator
9	9606.ENSP00000356807	0.764	TIP41-like protein
10	9606.ENSP00000401564	0.751	Ran-specific GTPase-activating protein
11	9606.ENSP00000470252	0.744	Transcription elongation factor SPT5
12	9606.ENSP00000418447	0.739	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
13	9606.ENSP00000363017	0.723	Replication protein A 32 kDa subunit
14	9606.ENSP00000358497	0.705	mRNA-capping enzyme
15	9606.ENSP00000221138	0.692	Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
16	9606.ENSP00000305924	0.679	Serine/threonine-protein phosphatase 4 regulatory subunit 4
17	9606.ENSP00000341779	0.677	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
18	9606.ENSP00000245932	0.657	Vasodilator-stimulated phosphoprotein
19	9606.ENSP00000377655	0.650	Sentrin-specific protease 7
20	9606.ENSP00000229238	0.644	Mitochondrial ribosomal protein L51

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0080090	0.988	regulation of primary metabolic process
GO:0008152	0.986	metabolic process
GO:0009987	0.983	cellular process
GO:0031323	0.983	regulation of cellular metabolic process
GO:0048522	0.967	positive regulation of cellular process
GO:0044238	0.956	primary metabolic process
GO:0060255	0.951	regulation of macromolecule metabolic process
GO:0048583	0.942	regulation of response to stimulus
GO:0071704	0.931	organic substance metabolic process
GO:0009893	0.923	positive regulation of metabolic process
GO:0051171	0.922	regulation of nitrogen compound metabolic process
GO:0044237	0.896	cellular metabolic process
GO:0006807	0.886	nitrogen compound metabolic process
GO:0051052	0.878	regulation of DNA metabolic process
GO:0043170	0.872	macromolecule metabolic process
GO:0080134	0.852	regulation of response to stress
GO:2001020	0.840	regulation of response to DNA damage stimulus
GO:0006282	0.750	regulation of DNA repair
GO:2000779	0.723	regulation of double-strand break repair
GO:0031325	0.721	positive regulation of cellular metabolic process
GO:0009889	0.715	regulation of biosynthetic process
GO:1901564	0.585	organonitrogen compound metabolic process
GO:0019538	0.577	protein metabolic process
GO:0036211	0.572	protein modification process
GO:0031326	0.559	regulation of cellular biosynthetic process
GO:0006796	0.455	phosphate-containing compound metabolic process
GO:0006470	0.411	protein dephosphorylation
GO:0050896	0.356	response to stimulus
GO:0048519	0.320	negative regulation of biological process
GO:0048523	0.308	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008287	0.997	protein serine/threonine phosphatase complex
GO:0005654	0.996	nucleoplasm
GO:0043232	0.988	intracellular non-membrane-bounded organelle
GO:0005737	0.987	cytoplasm
GO:0005829	0.869	cytosol
GO:0005694	0.774	chromosome
GO:0030289	0.680	protein phosphatase 4 complex
GO:0016604	0.638	nuclear body
GO:0016607	0.532	nuclear speck
GO:0005815	0.305	microtubule organizing center

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]