StarFunc result for job id Q5MJ68

User Input

>input (293 residues)
MLWAIPELGSPCPISISYEMSDSQDPTTSPVVTTQVELGGCSRQGGGNGFLRFRQHQEVQ
AFLSLLEDSFVQEFLSKDPCFQISDKYLLAMVLVYFQRAHLKLSEYTHSSLFLALYLAND
MEEDLEGPKCEIFPWALGKDWCLRVGKFLHQRDKLWARMGFRAVVSRQCCEEVMAKEPFH
WAWTRDRRPHHGGVQRVCPQVPVRLPRGPGLSPPHCSPCGLPQHCSSHLLKPVSSKCPSL
TSECHRPPSQNYLSRVKNAWGGDFLIVLPPQMQLEPGTYSLRIFPKPPARPGH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5MJ68	1.000	1.000	2.922E-42	293	1.000	1.000	Q5MJ68.pdb.gz	SPDYC_HUMAN Speedy protein C OS=Homo sapiens OX=9606 GN=SPDYC PE=1 SV=1
2	AFDB:Q9YGL1	0.552	0.543	4.187E-18	298	0.399	0.393	Q9YGL1.pdb.gz	SPD1B_XENLA Speedy protein 1-B OS=Xenopus laevis OX=8355 GN=spdya-b PE=1 SV=1
3	AFDB:Q9PU13	0.548	0.537	5.867E-18	299	0.399	0.391	Q9PU13.pdb.gz	SPD1A_XENLA Speedy protein 1-A OS=Xenopus laevis OX=8355 GN=spdya-a PE=1 SV=2
4	AFDB:A0A384MTT5	0.562	0.527	1.555E-16	313	0.334	0.313	A0A384MTT5.pdb.gz	A0A384MTT5_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 GN=SPDY1 PE=2 SV=1
5	AFDB:Q5IBH7	0.549	0.519	8.404E-16	310	0.355	0.335	Q5IBH7.pdb.gz	SPDYA_MOUSE Speedy protein A OS=Mus musculus OX=10090 GN=Spdya PE=1 SV=2
6	AFDB:Q5IBH6	0.438	0.478	1.370E-10	268	0.229	0.250	Q5IBH6.pdb.gz	SPE4A_MOUSE Speedy protein E4A OS=Mus musculus OX=10090 GN=Spdye4a PE=1 SV=1
7	AFDB:P0DTA3	0.435	0.479	1.583E-10	265	0.232	0.257	P0DTA3.pdb.gz	SPD11_HUMAN Putative speedy protein E11 OS=Homo sapiens OX=9606 GN=SPDYE11 PE=5 SV=1
8	AFDB:A6NLX3	0.433	0.533	2.218E-10	237	0.232	0.287	A6NLX3.pdb.gz	SPDE4_HUMAN Speedy protein E4 OS=Homo sapiens OX=9606 GN=SPDYE4 PE=1 SV=2
9	AFDB:P0CI01	0.430	0.319	6.871E-8	402	0.235	0.172	P0CI01.pdb.gz	SPDE6_HUMAN Speedy protein E6 OS=Homo sapiens OX=9606 GN=SPDYE6 PE=1 SV=2
10	AFDB:Q389J6	0.277	0.102	3.561E-2	899	0.174	0.057	Q389J6.pdb.gz	Q389J6_TRYB2 CYC2-like cyclin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.26.0510 PE=4 SV=1
11	PDB:6erpA	0.110	0.047	4.808E-1	1011	0.082	0.024	6erpA.pdb.gz	Structural Basis of Mitochondrial Transcription Initiation.
12	PDB:5hbhB	0.254	0.273	5.295E-1	270	0.078	0.085	5hbhB.pdb.gz	Discovery of Potent, Selective, and Orally Bioavailable Small-Molecule Modulators of the Mediator Complex-Associated Kinases CDK8 and CDK19.
13	PDB:3spaA	0.110	0.051	7.786E-1	941	0.082	0.026	3spaA.pdb.gz	Structure of human mitochondrial RNA polymerase
14	PDB:1zp2A	0.223	0.279	8.574E-1	227	0.075	0.097	1zp2A.pdb.gz
15	PDB:4f0tA	0.117	0.159	9.908E-1	162	0.051	0.093	4f0tA.pdb.gz
16	PDB:1o0lA	0.114	0.164	1.529	188	0.082	0.128	1o0lA.pdb.gz
17	PDB:3e6uA	0.111	0.091	1.529	409	0.058	0.042	3e6uA.pdb.gz	Structure of human lanthionine synthetase C-like protein 1 and its interaction with Eps8 and glutathione
18	PDB:2w96A	0.239	0.275	1.604	249	0.065	0.076	2w96A.pdb.gz
19	PDB:1g3nC	0.255	0.311	1.684	233	0.048	0.060	1g3nC.pdb.gz
20	PDB:2fbqA	0.130	0.162	1.945	213	0.068	0.094	2fbqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5MJ68	0.0	603	293	1.000	1.000	SPDYC_HUMAN Speedy protein C OS=Homo sapiens OX=9606 GN=SPDYC PE=1 SV=1
2	Q9YGL1	1.50e-57	188	298	0.382	0.376	SPD1B_XENLA Speedy protein 1-B OS=Xenopus laevis OX=8355 GN=spdya-b PE=1 SV=1
3	Q9PU13	4.79e-56	184	299	0.348	0.341	SPD1A_XENLA Speedy protein 1-A OS=Xenopus laevis OX=8355 GN=spdya-a PE=1 SV=2
4	A0A384MTT5	4.96e-54	180	313	0.300	0.281	A0A384MTT5_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 GN=SPDY1 PE=2 SV=1
5	Q5MJ70	4.96e-54	180	313	0.300	0.281	SPDYA_HUMAN Speedy protein A OS=Homo sapiens OX=9606 GN=SPDYA PE=1 SV=2
6	Q5IBH7	6.12e-54	179	310	0.300	0.284	SPDYA_MOUSE Speedy protein A OS=Mus musculus OX=10090 GN=Spdya PE=1 SV=2
7	Q4R1K5	7.23e-54	179	311	0.300	0.283	Q4R1K5_PIG Rapid inducer of G2/M progression in oocytes OS=Sus scrofa OX=9823 GN=RINGO PE=2 SV=1
8	Q5IBH6	4.11e-28	111	268	0.205	0.224	SPE4A_MOUSE Speedy protein E4A OS=Mus musculus OX=10090 GN=Spdye4a PE=1 SV=1
9	A6NLX3	3.04e-27	108	237	0.208	0.257	SPDE4_HUMAN Speedy protein E4 OS=Homo sapiens OX=9606 GN=SPDYE4 PE=1 SV=2
10	P0DTA3	5.28e-23	97.4	265	0.208	0.230	SPD11_HUMAN Putative speedy protein E11 OS=Homo sapiens OX=9606 GN=SPDYE11 PE=5 SV=1
11	P0CI01	3.36e-16	80.1	402	0.140	0.102	SPDE6_HUMAN Speedy protein E6 OS=Homo sapiens OX=9606 GN=SPDYE6 PE=1 SV=2
12	Q495Y8	3.39e-16	80.1	402	0.140	0.102	SPDE2_HUMAN Speedy protein E2 OS=Homo sapiens OX=9606 GN=SPDYE2 PE=1 SV=2
13	Q96L91	1.6	33.1	3159	0.061	0.006	EP400_HUMAN E1A-binding protein p400 OS=Homo sapiens OX=9606 GN=EP400 PE=1 SV=4
14	A0A0A0MR80	2.6	32.3	985	0.061	0.018	A0A0A0MR80_HUMAN E1A binding protein p400 OS=Homo sapiens OX=9606 GN=EP400 PE=1 SV=1
15	Q6T707	4.9	31.2	353	0.075	0.062	SCD4_MOUSE Stearoyl-CoA desaturase 4 OS=Mus musculus OX=10090 GN=Scd4 PE=1 SV=1
16	D3ZQ89	5.3	31.2	3034	0.058	0.006	D3ZQ89_RAT E1A binding protein p400 OS=Rattus norvegicus OX=10116 GN=Ep400 PE=1 SV=1
17	A0A0G2JU09	5.5	31.2	3152	0.058	0.005	A0A0G2JU09_RAT E1A binding protein p400 OS=Rattus norvegicus OX=10116 GN=Ep400 PE=1 SV=1
18	A0A8I5ZTE5	5.5	31.2	2998	0.058	0.006	A0A8I5ZTE5_RAT E1A binding protein p400 OS=Rattus norvegicus OX=10116 GN=Ep400 PE=1 SV=1
19	A0A8I6G935	5.5	31.2	3146	0.058	0.005	A0A8I6G935_RAT E1A binding protein p400 OS=Rattus norvegicus OX=10116 GN=Ep400 PE=1 SV=1
20	Q8CHI8	7.5	30.8	3072	0.055	0.005	EP400_MOUSE E1A-binding protein p400 OS=Mus musculus OX=10090 GN=Ep400 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11357 Spy1	5.8e-57	203.0	Cell cycle regulatory protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000366390

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000266970	0.817	Cyclin-dependent kinase 2
2	9606.ENSP00000378699	0.806	Cyclin-dependent kinase 1
3	9606.ENSP00000321656	0.600	M-phase inducer phosphatase 3
4	9606.ENSP00000300976	0.517	Kelch-like protein 26
5	9606.ENSP00000357547	0.504	Nuclear pore membrane glycoprotein 210-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019901	1.000	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0031323	0.981	regulation of cellular metabolic process
GO:0009987	0.974	cellular process
GO:0051726	0.958	regulation of cell cycle
GO:0007049	0.935	cell cycle
GO:0051171	0.926	regulation of nitrogen compound metabolic process
GO:0080090	0.925	regulation of primary metabolic process
GO:0060255	0.924	regulation of macromolecule metabolic process
GO:0071900	0.912	regulation of protein serine/threonine kinase activity
GO:0048518	0.905	positive regulation of biological process
GO:0048522	0.901	positive regulation of cellular process
GO:0022402	0.893	cell cycle process
GO:0000079	0.893	regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0022414	0.845	reproductive process
GO:0044770	0.698	cell cycle phase transition
GO:0031325	0.661	positive regulation of cellular metabolic process
GO:0033674	0.641	positive regulation of kinase activity
GO:0071704	0.621	organic substance metabolic process
GO:0006807	0.589	nitrogen compound metabolic process
GO:0044238	0.544	primary metabolic process
GO:0045787	0.541	positive regulation of cell cycle
GO:0043170	0.525	macromolecule metabolic process
GO:0001934	0.494	positive regulation of protein phosphorylation
GO:0044237	0.434	cellular metabolic process
GO:0045860	0.401	positive regulation of protein kinase activity
GO:0010646	0.394	regulation of cell communication
GO:0023051	0.385	regulation of signaling
GO:0010564	0.382	regulation of cell cycle process
GO:0044839	0.379	cell cycle G2/M phase transition
GO:0090304	0.341	nucleic acid metabolic process
GO:0050896	0.333	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.997	cytoplasm
GO:0005634	0.997	nucleus
GO:0070013	0.985	intracellular organelle lumen
GO:0031981	0.979	nuclear lumen
GO:0005829	0.961	cytosol
GO:0005654	0.952	nucleoplasm
GO:0032991	0.794	protein-containing complex
GO:0012505	0.538	endomembrane system
GO:0043232	0.418	intracellular non-membrane-bounded organelle
GO:0016020	0.373	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]