StarFunc result for job id Q5MJ70

User Input

>input (313 residues)
MRHNQMCCETPPTVTVYVKSGSNRSHQPKKPITLKRPICKDNWQAFEKNTHNNNKSKRPK
GPCLVIQRQDMTAFFKLFDDDLIQDFLWMDCCCKIADKYLLAMTFVYFKRAKFTISEHTR
INFFIALYLANTVEEDEEETKYEIFPWALGKNWRKLFPNFLKLRDQLWDRIDYRAIVSRR
CCEEVMAIAPTHYIWQRERSVHHSGAVRNYNRDEVQLPRGPSATPVDCSLCGKKRRYVRL
GLSSSSSLSSHTAGVTEKHSQDSYNSLSMDIIGDPSQAYTGSEVVNDHQSNKGKKTNFLK
KDKSMEWFTGSEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A384MTT5	0.701	0.701	2.692E-40	313	1.000	1.000	A0A384MTT5.pdb.gz	A0A384MTT5_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 GN=SPDY1 PE=2 SV=1
2	AFDB:Q5IBH7	0.912	0.920	1.394E-36	310	0.834	0.842	Q5IBH7.pdb.gz	SPDYA_MOUSE Speedy protein A OS=Mus musculus OX=10090 GN=Spdya PE=1 SV=2
3	AFDB:Q9PU13	0.543	0.568	9.466E-19	299	0.380	0.398	Q9PU13.pdb.gz	SPD1A_XENLA Speedy protein 1-A OS=Xenopus laevis OX=8355 GN=spdya-a PE=1 SV=2
4	AFDB:Q9YGL1	0.541	0.568	4.067E-18	298	0.387	0.406	Q9YGL1.pdb.gz	SPD1B_XENLA Speedy protein 1-B OS=Xenopus laevis OX=8355 GN=spdya-b PE=1 SV=1
5	AFDB:Q5MJ68	0.530	0.566	6.368E-16	293	0.297	0.317	Q5MJ68.pdb.gz	SPDYC_HUMAN Speedy protein C OS=Homo sapiens OX=9606 GN=SPDYC PE=1 SV=1
6	AFDB:Q5IBH6	0.407	0.475	2.372E-10	268	0.198	0.231	Q5IBH6.pdb.gz	SPE4A_MOUSE Speedy protein E4A OS=Mus musculus OX=10090 GN=Spdye4a PE=1 SV=1
7	AFDB:A6NLX3	0.410	0.539	3.500E-10	237	0.201	0.266	A6NLX3.pdb.gz	SPDE4_HUMAN Speedy protein E4 OS=Homo sapiens OX=9606 GN=SPDYE4 PE=1 SV=2
8	AFDB:P0DTA3	0.418	0.489	3.785E-9	265	0.204	0.242	P0DTA3.pdb.gz	SPD11_HUMAN Putative speedy protein E11 OS=Homo sapiens OX=9606 GN=SPDYE11 PE=5 SV=1
9	AFDB:P0CI01	0.384	0.300	1.759E-7	402	0.208	0.162	P0CI01.pdb.gz	SPDE6_HUMAN Speedy protein E6 OS=Homo sapiens OX=9606 GN=SPDYE6 PE=1 SV=2
10	AFDB:Q389J6	0.271	0.104	3.011E-2	899	0.163	0.057	Q389J6.pdb.gz	Q389J6_TRYB2 CYC2-like cyclin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.26.0510 PE=4 SV=1
11	PDB:7kpvB	0.207	0.221	2.332E-1	290	0.067	0.072	7kpvB.pdb.gz
12	PDB:5hbhB	0.224	0.253	2.570E-1	270	0.086	0.100	5hbhB.pdb.gz	Discovery of Potent, Selective, and Orally Bioavailable Small-Molecule Modulators of the Mediator Complex-Associated Kinases CDK8 and CDK19.
13	PDB:6erpA	0.089	0.045	6.162E-1	1011	0.064	0.020	6erpA.pdb.gz	Structural Basis of Mitochondrial Transcription Initiation.
14	PDB:4f0tA	0.135	0.208	1.478	162	0.032	0.062	4f0tA.pdb.gz
15	PDB:7f04C	0.116	0.129	1.795	231	0.080	0.108	7f04C.pdb.gz	Structures of the CcmABCD heme release complex at multiple states.
16	PDB:3spaA	0.100	0.047	1.884	941	0.061	0.020	3spaA.pdb.gz	Structure of human mitochondrial RNA polymerase
17	PDB:1zp2A	0.205	0.273	2.779	227	0.070	0.097	1zp2A.pdb.gz
18	PDB:2jkvA	0.091	0.066	3.215	482	0.045	0.029	2jkvA.pdb.gz	Structure of Human Phosphogluconate Dehydrogenase in Complex with Nadph at 2.53A
19	PDB:6pt0R	0.094	0.098	3.905	298	0.029	0.030	6pt0R.pdb.gz	Cryo-EM Structure of the Human Cannabinoid Receptor CB2-GiSignaling Complex.
20	PDB:3jd5O	0.129	0.205	4.100	173	0.032	0.058	3jd5O.pdb.gz	Cryo-EM structure of the small subunit of the mammalian mitochondrial ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A384MTT5	0.0	662	313	1.000	1.000	A0A384MTT5_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 GN=SPDY1 PE=2 SV=1
2	Q4R1K5	0.0	558	311	0.891	0.897	Q4R1K5_PIG Rapid inducer of G2/M progression in oocytes OS=Sus scrofa OX=9823 GN=RINGO PE=2 SV=1
3	Q5IBH7	0.0	523	310	0.834	0.842	SPDYA_MOUSE Speedy protein A OS=Mus musculus OX=10090 GN=Spdya PE=1 SV=2
4	Q5MJ70	0.0	662	313	1.000	1.000	SPDYA_HUMAN Speedy protein A OS=Homo sapiens OX=9606 GN=SPDYA PE=1 SV=2
5	Q9YGL1	4.25e-65	208	298	0.323	0.339	SPD1B_XENLA Speedy protein 1-B OS=Xenopus laevis OX=8355 GN=spdya-b PE=1 SV=1
6	Q9PU13	6.38e-65	208	299	0.339	0.355	SPD1A_XENLA Speedy protein 1-A OS=Xenopus laevis OX=8355 GN=spdya-a PE=1 SV=2
7	Q5MJ68	1.02e-57	189	293	0.281	0.300	SPDYC_HUMAN Speedy protein C OS=Homo sapiens OX=9606 GN=SPDYC PE=1 SV=1
8	A6NLX3	2.70e-25	103	237	0.176	0.232	SPDE4_HUMAN Speedy protein E4 OS=Homo sapiens OX=9606 GN=SPDYE4 PE=1 SV=2
9	Q5IBH6	2.24e-23	99.0	268	0.163	0.190	SPE4A_MOUSE Speedy protein E4A OS=Mus musculus OX=10090 GN=Spdye4a PE=1 SV=1
10	P0DTA3	7.39e-17	80.9	265	0.169	0.200	SPD11_HUMAN Putative speedy protein E11 OS=Homo sapiens OX=9606 GN=SPDYE11 PE=5 SV=1
11	P0CI01	1.78e-16	81.6	402	0.150	0.117	SPDE6_HUMAN Speedy protein E6 OS=Homo sapiens OX=9606 GN=SPDYE6 PE=1 SV=2
12	Q495Y8	1.85e-16	81.3	402	0.125	0.097	SPDE2_HUMAN Speedy protein E2 OS=Homo sapiens OX=9606 GN=SPDYE2 PE=1 SV=2
13	F4HPZ9	1.6	33.1	1396	0.070	0.016	LIG6_ARATH DNA ligase 6 OS=Arabidopsis thaliana OX=3702 GN=LIG6 PE=2 SV=1
14	Q8T4G5	4.0	31.6	826	0.054	0.021	Q8T4G5_DROME AFG3 like matrix AAA peptidase subunit 2, isoform A OS=Drosophila melanogaster OX=7227 GN=Afg3l2 PE=1 SV=1
15	P31512	5.0	31.2	558	0.054	0.030	FMO4_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Homo sapiens OX=9606 GN=FMO4 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19584 MCAfunc	1e+02	14.0	MCAfunc domain
2	PF11357 Spy1	1.9e-57	204.6	Cell cycle regulatory protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000335628

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000266970	0.999	Cyclin-dependent kinase 2
2	9606.ENSP00000228872	0.947	Cyclin-dependent kinase inhibitor 1B
3	9606.ENSP00000378699	0.900	Cyclin-dependent kinase 1
4	9606.ENSP00000338173	0.647	Pumilio homolog 2
5	9606.ENSP00000321656	0.620	M-phase inducer phosphatase 3
6	9606.ENSP00000255087	0.619	Tesmin
7	9606.ENSP00000321606	0.595	Dihydropyrimidinase-related protein 1
8	9606.ENSP00000353732	0.551	CAP-Gly domain-containing linker protein 3
9	9606.ENSP00000340644	0.525	Telomere repeats-binding bouquet formation protein 2
10	9606.ENSP00000438526	0.517	Kelch-like protein 35
11	9606.ENSP00000465204	0.513	Cyclin N-terminal domain containing 1
12	9606.ENSP00000255136	0.500	Polyadenylate-binding protein 1-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019901	1.000	protein kinase binding
GO:0008047	0.843	enzyme activator activity
GO:0019207	0.835	kinase regulator activity
GO:0019887	0.776	protein kinase regulator activity
GO:0019209	0.775	kinase activator activity
GO:0030295	0.727	protein kinase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0051347	0.995	positive regulation of transferase activity
GO:0051247	0.995	positive regulation of protein metabolic process
GO:0045859	0.995	regulation of protein kinase activity
GO:0045937	0.994	positive regulation of phosphate metabolic process
GO:0009987	0.988	cellular process
GO:0045860	0.983	positive regulation of protein kinase activity
GO:0007049	0.921	cell cycle
GO:0022402	0.913	cell cycle process
GO:0051726	0.879	regulation of cell cycle
GO:0050896	0.548	response to stimulus
GO:0071840	0.526	cellular component organization or biogenesis
GO:0071900	0.506	regulation of protein serine/threonine kinase activity
GO:0016043	0.462	cellular component organization
GO:0006950	0.427	response to stress
GO:0051716	0.416	cellular response to stimulus
GO:0010468	0.386	regulation of gene expression
GO:0071704	0.380	organic substance metabolic process
GO:0071902	0.376	positive regulation of protein serine/threonine kinase activity
GO:0044770	0.375	cell cycle phase transition
GO:0000278	0.340	mitotic cell cycle
GO:0006996	0.337	organelle organization
GO:0044237	0.335	cellular metabolic process
GO:1903047	0.332	mitotic cell cycle process
GO:0000079	0.325	regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0010564	0.307	regulation of cell cycle process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.995	nuclear lumen
GO:0005654	0.993	nucleoplasm
GO:0005737	0.819	cytoplasm
GO:0005829	0.796	cytosol
GO:0012505	0.477	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]