StarFunc result for job id Q5MNZ9

User Input

>input (446 residues)
MEAEAADAPPGGVESALSCFSFNQDCTSLATGTKAGYKLFSLSSVEQLDQVHGSNEIPDV
YIVERLFSSSLVVVVSHTKPRQMNVYHFKKGTEICNYSYSSNILSIRLNRQRLLVCLEES
IYIHNIKDMKLLKTLLDIPANPTGLCALSINHSNSYLAYPGSLTSGEIVLYDGNSLKTVC
TIAAHEGTLAAITFNASGSKLASASEKGTVIRVFSVPDGQKLYEFRRGMKRYVTISSLVF
SMDSQFLCASSNTETVHIFKLEQVTNSRPEEPSTWSGYMGKMFMAATNYLPTQVSDMMHQ
DRAFATARLNFSGQRNICTLSTIQKLPRLLVASSSGHLYMYNLDPQDGGECVLIKTHSLL
GSGTTEENKENDLRPSLPQSYAATVARPSASSASTVPGYSEDGGALRGEVIPEHEFATGP
VCLDDENEFPPIILCRGNQKGKTKQS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R8L5	0.845	0.845	8.931E-80	446	0.998	0.998	A0A024R8L5.pdb.gz
2	AFDB:A0A024R823	0.741	0.729	4.651E-54	454	0.547	0.537	A0A024R823.pdb.gz
3	AFDB:M9PER1	0.726	0.724	2.953E-47	447	0.422	0.421	M9PER1.pdb.gz	M9PER1_DROME Autophagy-related 18a, isoform E OS=Drosophila melanogaster OX=7227 GN=Atg18a PE=1 SV=1
4	AFDB:O16466	0.713	0.770	6.948E-43	412	0.370	0.400	O16466.pdb.gz	ATG18_CAEEL Autophagy-related protein 18 OS=Caenorhabditis elegans OX=6239 GN=atg-18 PE=1 SV=1
5	AFDB:Q9VIE1	0.692	0.656	5.706E-42	471	0.406	0.384	Q9VIE1.pdb.gz	Q9VIE1_DROME Autophagy-related 18b, isoform A OS=Drosophila melanogaster OX=7227 GN=Atg18b PE=2 SV=2
6	AFDB:P43601	0.672	0.602	1.065E-34	500	0.280	0.250	P43601.pdb.gz	ATG18_YEAST Autophagy-related protein 18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATG18 PE=1 SV=1
7	PDB:6kybB	0.655	0.881	6.741E-34	330	0.256	0.345	6kybB.pdb.gz
8	AFDB:Q9HDZ7	0.652	0.776	1.191E-33	373	0.269	0.322	Q9HDZ7.pdb.gz	ATG18_SCHPO Autophagy-related protein 18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atg18 PE=1 SV=1
9	AFDB:Q93VB2	0.663	0.695	1.029E-32	425	0.247	0.259	Q93VB2.pdb.gz	AT18A_ARATH Autophagy-related protein 18a OS=Arabidopsis thaliana OX=3702 GN=ATG18A PE=1 SV=1
10	AFDB:Q54SA0	0.657	0.829	4.887E-30	350	0.240	0.306	Q54SA0.pdb.gz	Q54SA0_DICDI WD repeat domain phosphoinositide-interacting protein 3 OS=Dictyostelium discoideum OX=44689 GN=wdr45l PE=4 SV=1
11	AFDB:Q9P6N1	0.647	0.852	2.550E-28	335	0.226	0.301	Q9P6N1.pdb.gz	MG179_SCHPO Autophagy-related protein 21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug179 PE=1 SV=1
12	PDB:6iyyA	0.619	0.870	5.581E-26	312	0.215	0.308	6iyyA.pdb.gz
13	PDB:5nnzA	0.507	0.651	5.820E-15	335	0.101	0.134	5nnzA.pdb.gz
14	PDB:5mzhB	0.520	0.555	7.208E-14	415	0.108	0.116	5mzhB.pdb.gz
15	PDB:7ajtUA	0.325	0.183	1.817E-13	834	0.108	0.058	7ajtUA.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
16	PDB:7mq8LO	0.275	0.153	1.817E-13	848	0.105	0.055	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:7jvrB	0.502	0.636	2.740E-13	342	0.112	0.146	7jvrB.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
18	PDB:7mqaLO	0.268	0.153	3.196E-13	819	0.101	0.055	7mqaLO.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:5o9zL	0.498	0.486	3.542E-13	459	0.085	0.083	5o9zL.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
20	PDB:7qdrC	0.523	0.734	4.132E-13	305	0.103	0.151	7qdrC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5MNZ9	0.0	927	446	1.000	1.000	WIPI1_HUMAN WD repeat domain phosphoinositide-interacting protein 1 OS=Homo sapiens OX=9606 GN=WIPI1 PE=1 SV=3
2	Q8R3E3	0.0	864	446	0.944	0.944	WIPI1_MOUSE WD repeat domain phosphoinositide-interacting protein 1 OS=Mus musculus OX=10090 GN=Wipi1 PE=1 SV=1
3	Q80W47	9.62e-174	496	445	0.547	0.548	WIPI2_MOUSE WD repeat domain phosphoinositide-interacting protein 2 OS=Mus musculus OX=10090 GN=Wipi2 PE=1 SV=1
4	Q9Y4P8	8.88e-172	491	454	0.543	0.533	WIPI2_HUMAN WD repeat domain phosphoinositide-interacting protein 2 OS=Homo sapiens OX=9606 GN=WIPI2 PE=1 SV=1
5	M9PHS3	3.14e-120	357	372	0.392	0.470	M9PHS3_DROME Autophagy-related 18a, isoform F OS=Drosophila melanogaster OX=7227 GN=Atg18a PE=1 SV=1
6	Q9VSF0	6.59e-120	356	377	0.395	0.467	Q9VSF0_DROME Autophagy-related 18a, isoform A OS=Drosophila melanogaster OX=7227 GN=Atg18a PE=1 SV=2
7	M9PER1	8.88e-120	358	447	0.404	0.403	M9PER1_DROME Autophagy-related 18a, isoform E OS=Drosophila melanogaster OX=7227 GN=Atg18a PE=1 SV=1
8	M9PEY7	2.67e-119	357	435	0.392	0.402	M9PEY7_DROME Autophagy-related 18a, isoform D OS=Drosophila melanogaster OX=7227 GN=Atg18a PE=1 SV=1
9	Q9VIE1	5.46e-106	324	471	0.422	0.399	Q9VIE1_DROME Autophagy-related 18b, isoform A OS=Drosophila melanogaster OX=7227 GN=Atg18b PE=2 SV=2
10	O16466	1.97e-95	295	412	0.354	0.383	ATG18_CAEEL Autophagy-related protein 18 OS=Caenorhabditis elegans OX=6239 GN=atg-18 PE=1 SV=1
11	Q9HDZ7	2.32e-56	192	373	0.274	0.327	ATG18_SCHPO Autophagy-related protein 18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atg18 PE=1 SV=1
12	Q54SA0	1.46e-41	152	350	0.260	0.331	Q54SA0_DICDI WD repeat domain phosphoinositide-interacting protein 3 OS=Dictyostelium discoideum OX=44689 GN=wdr45l PE=4 SV=1
13	Q93VB2	2.47e-36	140	425	0.238	0.249	AT18A_ARATH Autophagy-related protein 18a OS=Arabidopsis thaliana OX=3702 GN=ATG18A PE=1 SV=1
14	Q9P6N1	3.86e-36	137	335	0.226	0.301	MG179_SCHPO Autophagy-related protein 21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug179 PE=1 SV=1
15	Q5MNZ6	1.37e-33	131	344	0.226	0.294	WIPI3_HUMAN WD repeat domain phosphoinositide-interacting protein 3 OS=Homo sapiens OX=9606 GN=WDR45B PE=1 SV=2
16	Q9Y484	5.83e-28	115	360	0.188	0.233	WIPI4_HUMAN WD repeat domain phosphoinositide-interacting protein 4 OS=Homo sapiens OX=9606 GN=WDR45 PE=1 SV=1
17	P43601	4.80e-24	106	500	0.164	0.146	ATG18_YEAST Autophagy-related protein 18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATG18 PE=1 SV=1
18	Q9P3W2	2.14e-21	97.4	364	0.152	0.187	HSV2_SCHPO SVP1-like protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hsv2 PE=3 SV=1
19	Q86MP3	4.72e-15	79.0	388	0.161	0.186	EPG6_CAEEL Ectopic P granules protein 6 OS=Caenorhabditis elegans OX=6239 GN=epg-6 PE=1 SV=1
20	Q02887	2.17e-12	71.2	496	0.141	0.127	ATG21_YEAST Autophagy-related protein 21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATG21 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	7.7	18.2	Anaphase-promoting complex subunit 4 WD40 domain
2	PF12490 BCAS3	52	14.9	Breast carcinoma amplified sequence 3
3	PF18975 DUF5711	5.8	17.6	Family of unknown function (DUF5711)
4	PF00400 WD40	27	17.0	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262139

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000366475	0.994	Autophagy-related protein 2 homolog A
2	9606.ENSP00000353010	0.986	Autophagy-related protein 2 homolog B
3	9606.ENSP00000375872	0.979	Autophagy-related protein 16-1
4	9606.ENSP00000425107	0.968	Ubiquitin-like protein ATG12
5	9606.ENSP00000261776	0.965	Protein VAC14 homolog
6	9606.ENSP00000324560	0.949	Serine/threonine-protein kinase ULK1
7	9606.ENSP00000262039	0.948	Phosphatidylinositol 3-kinase catalytic subunit type 3
8	9606.ENSP00000355231	0.943	Beclin-1
9	9606.ENSP00000358072	0.938	Autophagy protein 5
10	9606.ENSP00000386710	0.938	Autophagy-related protein 9A
11	9606.ENSP00000346437	0.931	Ubiquitin-like modifier-activating enzyme ATG7
12	9606.ENSP00000216037	0.923	X-box-binding protein 1
13	9606.ENSP00000462729	0.913	OTU domain-containing protein 7B
14	9606.ENSP00000266458	0.910	Gamma-aminobutyric acid receptor-associated protein-like 1
15	9606.ENSP00000326340	0.908	Autophagy-related protein 16-2
16	9606.ENSP00000338990	0.908	Autophagy-related protein 101
17	9606.ENSP00000283290	0.904	Ubiquitin-like-conjugating enzyme ATG3
18	9606.ENSP00000037243	0.898	Gamma-aminobutyric acid receptor-associated protein-like 2
19	9606.ENSP00000404923	0.896	Tectonin beta-propeller repeat-containing protein 1
20	9606.ENSP00000349205	0.881	Phosphoinositide 3-kinase regulatory subunit 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0032266	0.746	phosphatidylinositol-3-phosphate binding
GO:0080025	0.521	phosphatidylinositol-3,5-bisphosphate binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.990	cellular metabolic process
GO:0007033	0.987	vacuole organization
GO:0070925	0.987	organelle assembly
GO:0010506	0.986	regulation of autophagy
GO:0009605	0.981	response to external stimulus
GO:0000045	0.966	autophagosome assembly
GO:0007154	0.963	cell communication
GO:0033554	0.955	cellular response to stress
GO:0051179	0.948	localization
GO:0031667	0.948	response to nutrient levels
GO:0051641	0.942	cellular localization
GO:0044088	0.927	regulation of vacuole organization
GO:0016241	0.926	regulation of macroautophagy
GO:0031331	0.925	positive regulation of cellular catabolic process
GO:0071496	0.874	cellular response to external stimulus
GO:0051234	0.821	establishment of localization
GO:0016192	0.806	vesicle-mediated transport
GO:0009267	0.765	cellular response to starvation
GO:0051649	0.685	establishment of localization in cell
GO:0044238	0.620	primary metabolic process
GO:0071704	0.582	organic substance metabolic process
GO:0010508	0.551	positive regulation of autophagy
GO:0048193	0.517	Golgi vesicle transport
GO:0043170	0.417	macromolecule metabolic process
GO:0051130	0.398	positive regulation of cellular component organization
GO:0010638	0.380	positive regulation of organelle organization
GO:0044087	0.365	regulation of cellular component biogenesis
GO:0016239	0.356	positive regulation of macroautophagy
GO:1902115	0.347	regulation of organelle assembly
GO:0046907	0.322	intracellular transport
GO:0006807	0.303	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0016020	0.990	membrane
GO:0000407	0.988	phagophore assembly site
GO:0005829	0.966	cytosol
GO:0031090	0.938	organelle membrane
GO:0012505	0.931	endomembrane system
GO:0005776	0.885	autophagosome
GO:0098588	0.876	bounding membrane of organelle
GO:0005768	0.651	endosome
GO:0005774	0.606	vacuolar membrane
GO:0030659	0.528	cytoplasmic vesicle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]