StarFunc result for job id Q5MY95

User Input

>input (495 residues)
MGLSRKEQVFLALLGASGVSGLTALILLLVEATSVLLPTDIKFGIVFDAGSSHTSLFLYQ
WLANKENGTGVVSQALACQVEGPGISSYTSNAAQAGESLQGCLEEALVLIPEAQHRKTPT
FLGATAGMRLLSRKNSSQARDIFAAVTQVLGRSPVDFWGAELLAGQAEGAFGWITVNYGL
GTLVKYSFTGEWIQPPEEMLVGALDMGGASTQITFVPGGPILDKSTQADFRLYGSDYSVY
THSYLCFGRDQMLSRLLVGLVQSRPAALLRHPCYLSGYQTTLALGPLYESPCVHATPPLS
LPQNLTVEGTGNPGACVSAIRELFNFSSCQGQEDCAFDGVYQPPLRGQFYAFSNFYYTFH
FLNLTSRQPLSTVNATIWEFCQRPWKLVEASYPGQDRWLRDYCASGLYILTLLHEGYGFS
EETWPSLEFRKQAGGVDIGWTLGYMLNLTGMIPADAPAQWRAESYGVWVAKVVFMVLALV
AVVGAALVQLFWLQD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5MY95	1.000	1.000	2.486E-101	495	1.000	1.000	Q5MY95.pdb.gz	ENTP8_HUMAN Ectonucleoside triphosphate diphosphohydrolase 8 OS=Homo sapiens OX=9606 GN=ENTPD8 PE=1 SV=2
2	AFDB:Q8K0L2	0.973	0.969	3.019E-82	497	0.743	0.740	Q8K0L2.pdb.gz	ENTP8_MOUSE Ectonucleoside triphosphate diphosphohydrolase 8 OS=Mus musculus OX=10090 GN=Entpd8 PE=1 SV=3
3	AFDB:Q9Y5L3	0.873	0.873	4.501E-58	495	0.426	0.426	Q9Y5L3.pdb.gz	ENTP2_HUMAN Ectonucleoside triphosphate diphosphohydrolase 2 OS=Homo sapiens OX=9606 GN=ENTPD2 PE=1 SV=1
4	AFDB:O35795	0.870	0.870	1.947E-57	495	0.420	0.420	O35795.pdb.gz	ENTP2_RAT Ectonucleoside triphosphate diphosphohydrolase 2 OS=Rattus norvegicus OX=10116 GN=Entpd2 PE=1 SV=1
5	AFDB:A0A1D5PS27	0.856	0.854	2.419E-57	496	0.414	0.413	A0A1D5PS27.pdb.gz	A0A1D5PS27_CHICK Ectonucleoside triphosphate diphosphohydrolase 2 OS=Gallus gallus OX=9031 GN=ENTPD2 PE=3 SV=1
6	AFDB:Q8BFW6	0.851	0.799	2.554E-57	529	0.382	0.357	Q8BFW6.pdb.gz	ENTP3_MOUSE Ectonucleoside triphosphate diphosphohydrolase 3 OS=Mus musculus OX=10090 GN=Entpd3 PE=1 SV=1
7	AFDB:O75355	0.853	0.800	2.007E-56	529	0.382	0.357	O75355.pdb.gz	ENTP3_HUMAN Ectonucleoside triphosphate diphosphohydrolase 3 OS=Homo sapiens OX=9606 GN=ENTPD3 PE=1 SV=2
8	AFDB:P49961	0.835	0.812	1.022E-55	510	0.408	0.396	P49961.pdb.gz	ENTP1_HUMAN Ectonucleoside triphosphate diphosphohydrolase 1 OS=Homo sapiens OX=9606 GN=ENTPD1 PE=1 SV=1
9	AFDB:F1RDI7	0.892	0.880	1.494E-55	502	0.382	0.376	F1RDI7.pdb.gz
10	AFDB:E7FG27	0.809	0.807	3.291E-54	496	0.408	0.407	E7FG27.pdb.gz	E7FG27_DANRE Ectonucleoside triphosphate diphosphohydrolase 1 OS=Danio rerio OX=7955 GN=zgc:100819 PE=1 SV=1
11	PDB:1u6zB	0.382	0.378	2.115E-7	500	0.097	0.096	1u6zB.pdb.gz
12	PDB:6pbzA	0.395	0.402	3.091E-7	485	0.121	0.124	6pbzA.pdb.gz
13	PDB:6pbzD	0.355	0.381	2.246E-5	454	0.095	0.104	6pbzD.pdb.gz
14	PDB:1ig8A	0.302	0.314	7.018E-5	469	0.105	0.111	1ig8A.pdb.gz
15	PDB:3wquB	0.192	0.243	6.147E-4	371	0.061	0.081	3wquB.pdb.gz	Crystal structure of FtsA from Staphylococcus aureus
16	PDB:4dchA	0.256	0.281	8.512E-4	434	0.105	0.120	4dchA.pdb.gz	Insights into Mechanism of Glucokinase Activation: OBSERVATION OF MULTIPLE DISTINCT PROTEIN CONFORMATIONS.
17	PDB:5i9eC	0.209	0.246	8.512E-4	404	0.067	0.082	5i9eC.pdb.gz	Crystal structure of a nuclear actin ternary complex.
18	PDB:3qb0B	0.190	0.214	1.002E-3	430	0.067	0.077	3qb0B.pdb.gz	Structural biochemistry of nuclear actin-related proteins 4 and 8 reveals their interaction with actin.
19	PDB:6w17A	0.194	0.231	1.002E-3	380	0.105	0.137	6w17A.pdb.gz	Cryo-EM reveals the transition of Arp2/3 complex from inactive to nucleation-competent state.
20	PDB:1qhaA	0.307	0.193	1.387E-3	903	0.109	0.060	1qhaA.pdb.gz	Binding of non-catalytic ATP to human hexokinase I highlights the structural components for enzyme-membrane association control.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5MY95	0.0	1011	495	1.000	1.000	ENTP8_HUMAN Ectonucleoside triphosphate diphosphohydrolase 8 OS=Homo sapiens OX=9606 GN=ENTPD8 PE=1 SV=2
2	Q8K0L2	0.0	780	497	0.743	0.740	ENTP8_MOUSE Ectonucleoside triphosphate diphosphohydrolase 8 OS=Mus musculus OX=10090 GN=Entpd8 PE=1 SV=3
3	P49961	3.69e-136	404	510	0.438	0.425	ENTP1_HUMAN Ectonucleoside triphosphate diphosphohydrolase 1 OS=Homo sapiens OX=9606 GN=ENTPD1 PE=1 SV=1
4	A0A1D5PS27	4.56e-136	404	496	0.408	0.407	A0A1D5PS27_CHICK Ectonucleoside triphosphate diphosphohydrolase 2 OS=Gallus gallus OX=9031 GN=ENTPD2 PE=3 SV=1
5	P79784	2.66e-134	399	495	0.408	0.408	ENTP2_CHICK Ectonucleoside triphosphate diphosphohydrolase 2 OS=Gallus gallus OX=9031 GN=ENTPD2 PE=1 SV=2
6	Q9Y5L3	1.51e-133	397	495	0.404	0.404	ENTP2_HUMAN Ectonucleoside triphosphate diphosphohydrolase 2 OS=Homo sapiens OX=9606 GN=ENTPD2 PE=1 SV=1
7	O55026	5.46e-132	393	495	0.414	0.414	ENTP2_MOUSE Ectonucleoside triphosphate diphosphohydrolase 2 OS=Mus musculus OX=10090 GN=Entpd2 PE=1 SV=2
8	O35795	1.12e-129	387	495	0.406	0.406	ENTP2_RAT Ectonucleoside triphosphate diphosphohydrolase 2 OS=Rattus norvegicus OX=10116 GN=Entpd2 PE=1 SV=1
9	Q6DC46	1.35e-125	377	492	0.412	0.415	Q6DC46_DANRE Ectonucleoside triphosphate diphosphohydrolase 1 OS=Danio rerio OX=7955 GN=zgc:100819 PE=1 SV=1
10	Q66L64	3.99e-125	376	502	0.400	0.394	Q66L64_DANRE Ectonucleoside triphosphate diphosphohydrolase 2 a.1 OS=Danio rerio OX=7955 GN=si:rp71-1o1.2 PE=2 SV=1
11	P55772	4.17e-125	376	510	0.402	0.390	ENTP1_MOUSE Ectonucleoside triphosphate diphosphohydrolase 1 OS=Mus musculus OX=10090 GN=Entpd1 PE=1 SV=1
12	P97687	5.34e-125	376	511	0.408	0.395	ENTP1_RAT Ectonucleoside triphosphate diphosphohydrolase 1 OS=Rattus norvegicus OX=10116 GN=Entpd1 PE=1 SV=1
13	E7FG27	3.50e-124	373	496	0.402	0.401	E7FG27_DANRE Ectonucleoside triphosphate diphosphohydrolase 1 OS=Danio rerio OX=7955 GN=zgc:100819 PE=1 SV=1
14	O75355	3.71e-123	372	529	0.368	0.344	ENTP3_HUMAN Ectonucleoside triphosphate diphosphohydrolase 3 OS=Homo sapiens OX=9606 GN=ENTPD3 PE=1 SV=2
15	Q8BFW6	1.11e-120	365	529	0.366	0.342	ENTP3_MOUSE Ectonucleoside triphosphate diphosphohydrolase 3 OS=Mus musculus OX=10090 GN=Entpd3 PE=1 SV=1
16	Q6NQA8	9.29e-42	157	488	0.265	0.268	APY5_ARATH Probable apyrase 5 OS=Arabidopsis thaliana OX=3702 GN=APY5 PE=2 SV=1
17	Q21815	5.97e-35	139	552	0.236	0.212	MIG23_CAEEL Nucleoside-diphosphatase mig-23 OS=Caenorhabditis elegans OX=6239 GN=mig-23 PE=1 SV=2
18	Q9Y227	4.05e-34	137	616	0.269	0.216	ENTP4_HUMAN Ectonucleoside triphosphate diphosphohydrolase 4 OS=Homo sapiens OX=9606 GN=ENTPD4 PE=1 SV=1
19	O80612	7.47e-31	127	555	0.230	0.205	APY6_ARATH Probable apyrase 6 OS=Arabidopsis thaliana OX=3702 GN=APY6 PE=2 SV=2
20	O75356	1.19e-30	125	428	0.242	0.280	ENTP5_HUMAN Nucleoside diphosphate phosphatase ENTPD5 OS=Homo sapiens OX=9606 GN=ENTPD5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01150 GDA1_CD39	3.2e-95	330.9	GDA1/CD39 (nucleoside phosphatase) family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360561

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354238	0.963	Ectonucleotide pyrophosphatase/phosphodiesterase family member 1
2	9606.ENSP00000406261	0.961	Ectonucleotide pyrophosphatase/phosphodiesterase family member 3
3	9606.ENSP00000304802	0.960	Thymidylate kinase
4	9606.ENSP00000232607	0.952	Uridine 5'-monophosphate synthase
5	9606.ENSP00000286648	0.950	Deoxycytidine kinase
6	9606.ENSP00000286621	0.941	Adenosine kinase
7	9606.ENSP00000236959	0.938	Bifunctional purine biosynthesis protein PURH
8	9606.ENSP00000369456	0.938	Inosine triphosphate pyrophosphatase
9	9606.ENSP00000430075	0.938	AMP deaminase 1
10	9606.ENSP00000361285	0.934	Uridine-cytidine kinase 1
11	9606.ENSP00000361704	0.934	CTP synthase 1
12	9606.ENSP00000379802	0.929	AMP deaminase 3
13	9606.ENSP00000401264	0.929	CTP synthase 2
14	9606.ENSP00000346155	0.928	Uridine-cytidine kinase-like 1
15	9606.ENSP00000256578	0.925	AMP deaminase 2
16	9606.ENSP00000300738	0.922	Ribonucleoside-diphosphate reductase large subunit
17	9606.ENSP00000315644	0.922	Thymidylate synthase
18	9606.ENSP00000355587	0.920	Cancer-related nucleoside-triphosphatase
19	9606.ENSP00000299697	0.918	Thymidine kinase 2, mitochondrial
20	9606.ENSP00000301634	0.917	Thymidine kinase, cytosolic

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0017110	1.000	nucleoside diphosphate phosphatase activity
GO:0017111	0.974	ribonucleoside triphosphate phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0071704	0.985	organic substance metabolic process
GO:0044237	0.985	cellular metabolic process
GO:0044238	0.972	primary metabolic process
GO:1901360	0.954	organic cyclic compound metabolic process
GO:0006807	0.903	nitrogen compound metabolic process
GO:0006725	0.903	cellular aromatic compound metabolic process
GO:0006753	0.805	nucleoside phosphate metabolic process
GO:0009132	0.764	nucleoside diphosphate metabolic process
GO:0044249	0.736	cellular biosynthetic process
GO:0050896	0.701	response to stimulus
GO:0034654	0.643	nucleobase-containing compound biosynthetic process
GO:1901293	0.599	nucleoside phosphate biosynthetic process
GO:1901564	0.539	organonitrogen compound metabolic process
GO:0065007	0.510	biological regulation
GO:0009117	0.485	nucleotide metabolic process
GO:0051716	0.449	cellular response to stimulus
GO:0050789	0.374	regulation of biological process
GO:1901135	0.373	carbohydrate derivative metabolic process
GO:0050794	0.357	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.996	membrane
GO:0071944	0.981	cell periphery
GO:0005886	0.967	plasma membrane
GO:0005829	0.519	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:36799	1.000	a ribonucleoside 5'-diphosphate + H2O = a ribonucleoside 5'-phosphate + H(+) + phosphate
EC:3.6.1.6	1.000	nucleoside diphosphate phosphatase.
RHEA:23680	0.974	a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate
EC:3.6.1.15	0.974	nucleoside-triphosphate phosphatase.

[back to server]