StarFunc result for job id Q5PRF9

User Input

>input (694 residues)
MMFRDQVGILAGWFKGWNECEQTVALLSLLKRVTRTQARFLQLCLEHSLADCNDIHLLES
EANSAAIVSQWQQESKEKVVSLLLSHLPLLQPGNTEAKSEYMRLLQKVLAYSIESNAFIE
ESRQLLSYALIHPATTLEDRNALALWLSHLEERLASGFRSRPEPSYHSRQGSDEWGGPAE
LGPGEAGPGWQDKPPRENGHVPFHPSSSVPPAINSIGSNANTGLPCQIHPSPLKRSMSLI
PTSPQVPGEWPSPEELGARAAFTTPDHAPLSPQSSVASSGSEQTEEQGSSRNTFQEDGSG
MKDVPSWLKSLRLHKYAALFSQMSYEEMMTLTEQHLESQNVTKGARHKIALSIQKLRERQ
SVLKSLEKDVLEGGNLRNALQELQQIIITPIKAYSVLQATVAAATTTPTAKDGAPGEPPL
PGAEPPLAHPGTDKGTEAKDPPAVENYPPPPAPAPTDGSEPAPAPVADGDIPSQFTRVMG
KVCTQLLVSRPDEENITSYLQLIEKCLTHEAFTETQKKRLLSWKQQVLKLLRTFPRKAAL
EMQNYRQQKGWAFGSNSLPIAGSVGMGVARRTQRQFPMPPRALPPGRMGLLSPSGIGGVS
PRHALTSPSLGGQGRQNLWFANPGGSNSMPSQSRSSVQRTHSLPVHSSPQAILMFPPDCP
VPGPDLEINPTLESLCLSMTEHALGDGTDKTSTI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R0N7	0.339	0.339	5.344E-70	694	1.000	1.000	A0A024R0N7.pdb.gz
2	AFDB:Q9UPU9	0.308	0.299	1.426E-47	718	0.644	0.623	Q9UPU9.pdb.gz	SMAG1_HUMAN Protein Smaug homolog 1 OS=Homo sapiens OX=9606 GN=SAMD4A PE=1 SV=3
3	AFDB:F4I700	0.103	0.101	2.433E-1	717	0.107	0.103	F4I700.pdb.gz	UBN2_ARATH Ubinuclein-2 OS=Arabidopsis thaliana OX=3702 GN=UBN2 PE=1 SV=1
4	AFDB:O60424	0.075	0.063	3.273E-1	923	0.161	0.121	O60424.pdb.gz	O60424_HUMAN histone acetyltransferase (Fragment) OS=Homo sapiens OX=9606 GN=CBP PE=4 SV=1
5	AFDB:Q5SXM2	0.059	0.037	4.220E-1	1469	0.156	0.074	Q5SXM2.pdb.gz	SNPC4_HUMAN snRNA-activating protein complex subunit 4 OS=Homo sapiens OX=9606 GN=SNAPC4 PE=1 SV=1
6	AFDB:Q54GH3	0.097	0.101	4.999E-1	663	0.128	0.134	Q54GH3.pdb.gz	TOM1_DICDI Target of Myb protein 1 OS=Dictyostelium discoideum OX=44689 GN=tom1 PE=1 SV=1
7	AFDB:Q6P1E1	0.124	0.085	7.016E-1	1072	0.130	0.084	Q6P1E1.pdb.gz	ZMIZ1_MOUSE Zinc finger MIZ domain-containing protein 1 OS=Mus musculus OX=10090 GN=Zmiz1 PE=1 SV=1
8	PDB:7dvqK	0.079	0.198	8.647E-1	188	0.040	0.149	7dvqK.pdb.gz	Structure of the activated human minor spliceosome.
9	AFDB:P0DPF3	0.071	0.049	1.027	1111	0.101	0.063	P0DPF3.pdb.gz	NBPF9_HUMAN Neuroblastoma breakpoint family member 9 OS=Homo sapiens OX=9606 GN=NBPF9 PE=2 SV=1
10	AFDB:P78813	0.097	0.129	1.027	476	0.066	0.097	P78813.pdb.gz	YCTB_SCHPO ENTH domain-containing protein C794.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC794.11c PE=1 SV=2
11	AFDB:Q9C9H8	0.092	0.075	1.072	909	0.059	0.045	Q9C9H8.pdb.gz	SCY2B_ARATH SCY1-like protein 2 B OS=Arabidopsis thaliana OX=3702 GN=SCYL2B PE=1 SV=1
12	PDB:3euhB	0.061	0.118	1.565	321	0.024	0.053	3euhB.pdb.gz
13	PDB:1qoyA	0.051	0.105	3.082	303	0.032	0.073	1qoyA.pdb.gz
14	PDB:5ok9B	0.101	0.188	3.354	242	0.032	0.091	5ok9B.pdb.gz
15	PDB:4jhjA	0.062	0.146	3.499	216	0.029	0.093	4jhjA.pdb.gz	Structural and biochemical studies of SLIP1-SLBP identify DBP5 and eIF3g as SLIP1-binding proteins.
16	PDB:6ww7B	0.088	0.195	3.651	281	0.030	0.075	6ww7B.pdb.gz	Structural basis for membrane insertion by the human ER membrane protein complex.
17	PDB:4cabA	0.067	0.086	3.974	507	0.014	0.020	4cabA.pdb.gz	Structure of the Mono-Functional Heme Catalase Dr1998 from Deinococcus Radiodurans
18	PDB:6zu0C	0.044	0.064	3.974	426	0.032	0.052	6zu0C.pdb.gz
19	PDB:7qe7O	0.096	0.094	3.974	707	0.048	0.047	7qe7O.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
20	PDB:2btpA	0.086	0.192	4.146	248	0.032	0.089	2btpA.pdb.gz	Structural Basis for Protein-Protein Interactions in the 14-3-3 Protein Family.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	M0QZ22	0.0	1395	692	0.987	0.990	M0QZ22_HUMAN Sterile alpha motif domain containing 4B OS=Homo sapiens OX=9606 GN=SAMD4B PE=1 SV=1
2	M0R0X3	0.0	660	325	0.464	0.991	M0R0X3_HUMAN Sterile alpha motif domain containing 4B OS=Homo sapiens OX=9606 GN=SAMD4B PE=1 SV=1
3	Q5PRF9	0.0	1415	694	1.000	1.000	SMAG2_HUMAN Protein Smaug homolog 2 OS=Homo sapiens OX=9606 GN=SAMD4B PE=1 SV=1
4	Q80XS6	0.0	1362	687	0.967	0.977	SMAG2_MOUSE Protein Smaug homolog 2 OS=Mus musculus OX=10090 GN=Samd4b PE=1 SV=1
5	Q8CBY1	0.0	801	711	0.638	0.623	SMAG1_MOUSE Protein Smaug homolog 1 OS=Mus musculus OX=10090 GN=Samd4a PE=1 SV=2
6	Q9UPU9	0.0	806	718	0.643	0.621	SMAG1_HUMAN Protein Smaug homolog 1 OS=Homo sapiens OX=9606 GN=SAMD4A PE=1 SV=3
7	M0QY61	4.45e-157	454	219	0.316	1.000	M0QY61_HUMAN Sterile alpha motif domain containing 4B (Fragment) OS=Homo sapiens OX=9606 GN=SAMD4B PE=1 SV=1
8	G3V2R1	4.49e-100	312	345	0.262	0.528	G3V2R1_HUMAN Sterile alpha motif domain containing 4A OS=Homo sapiens OX=9606 GN=SAMD4A PE=1 SV=1
9	Q23972	3.37e-22	104	999	0.072	0.050	SMG_DROME Protein Smaug OS=Drosophila melanogaster OX=7227 GN=smg PE=1 SV=2
10	J9VVN9	3.98e-06	52.8	687	0.030	0.031	VTS1_CRYNH RNA-binding protein VTS1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=VTS1 PE=1 SV=1
11	Q9P6R7	7.43e-06	51.6	713	0.042	0.041	VTS1_SCHPO RNA-binding protein vts1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC13E7.03c PE=1 SV=1
12	Q8WYQ9	6.70e-05	48.9	949	0.030	0.022	ZCH14_HUMAN Zinc finger CCHC domain-containing protein 14 OS=Homo sapiens OX=9606 GN=ZCCHC14 PE=1 SV=1
13	Q08831	1.18e-04	47.8	523	0.037	0.050	VTS1_YEAST RNA-binding protein VTS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VTS1 PE=1 SV=1
14	Q9H694	0.032	40.0	974	0.039	0.028	BICC1_HUMAN Protein bicaudal C homolog 1 OS=Homo sapiens OX=9606 GN=BICC1 PE=1 SV=2
15	Q9VBP3	0.048	39.7	1181	0.043	0.025	TNKS_DROME Poly [ADP-ribose] polymerase tankyrase OS=Drosophila melanogaster OX=7227 GN=Tnks PE=1 SV=1
16	Q99MQ1	0.21	37.4	977	0.032	0.023	BICC1_MOUSE Protein bicaudal C homolog 1 OS=Mus musculus OX=10090 GN=Bicc1 PE=1 SV=1
17	G5EB26	0.57	35.8	886	0.062	0.049	G5EB26_EMENI MAPKK kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02269 PE=3 SV=1
18	A0A517FNC6	4.2	33.1	491	0.030	0.043	C9B51_TRIFG Cholesterol 22-monohydroxylase CYP90B51 OS=Trigonella foenum-graecum OX=78534 GN=CYP90B51 PE=1 SV=1
19	Q8INF0	4.7	33.1	1097	0.040	0.026	GCY8E_DROME Soluble guanylate cyclase 88E OS=Drosophila melanogaster OX=7227 GN=Gyc88E PE=1 SV=4
20	Q57W57	5.7	32.7	6062	0.032	0.004	Q57W57_TRYB2 PH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.28F8.60 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09246 PHAT	0.00045	31.2	PHAT
2	PF00536 SAM_1	2.5e-07	42.3	SAM domain (Sterile alpha motif)
3	PF07647 SAM_2	0.17	23.4	SAM domain (Sterile alpha motif)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000317224

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000393275	0.842	Nanos homolog 1
2	9606.ENSP00000432886	0.731	RNA-binding protein 40
3	9606.ENSP00000480279	0.724	Usher syndrome type-1G protein
4	9606.ENSP00000264335	0.689	14-3-3 protein epsilon
5	9606.ENSP00000375919	0.685	Protein Smaug homolog 1
6	9606.ENSP00000298097	0.666	F-box only protein 33
7	9606.ENSP00000479953	0.661	Volume-regulated anion channel subunit LRRC8E
8	9606.ENSP00000005226	0.623	Harmonin
9	9606.ENSP00000298351	0.606	Calcium permeable stress-gated cation channel 1
10	9606.ENSP00000338173	0.583	Pumilio homolog 2
11	9606.ENSP00000204726	0.579	Golgin subfamily A member 3
12	9606.ENSP00000380258	0.578	ADP-ribosyltransferase 5
13	9606.ENSP00000235090	0.577	Methylosome protein 50
14	9606.ENSP00000446271	0.559	Protein LSM14 homolog A
15	9606.ENSP00000341021	0.554	Nanos homolog 2
16	9606.ENSP00000380659	0.537	Eukaryotic translation initiation factor 4E transporter
17	9606.ENSP00000379287	0.534	14-3-3 protein zeta/delta
18	9606.ENSP00000356444	0.533	Sterile alpha motif domain containing 5
19	9606.ENSP00000323527	0.524	Muskelin
20	9606.ENSP00000391723	0.516	Pumilio homolog 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0045182	0.774	translation regulator activity
GO:0030371	0.759	translation repressor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.985	multicellular organismal process
GO:0009987	0.983	cellular process
GO:0032502	0.925	developmental process
GO:0048731	0.919	system development
GO:0007399	0.912	nervous system development
GO:0060322	0.874	head development
GO:0065007	0.866	biological regulation
GO:0050789	0.862	regulation of biological process
GO:0007420	0.842	brain development
GO:0050794	0.841	regulation of cellular process
GO:0030902	0.810	hindbrain development
GO:0019222	0.715	regulation of metabolic process
GO:0060255	0.711	regulation of macromolecule metabolic process
GO:0031323	0.705	regulation of cellular metabolic process
GO:0080090	0.699	regulation of primary metabolic process
GO:0051171	0.699	regulation of nitrogen compound metabolic process
GO:0010468	0.699	regulation of gene expression
GO:0048518	0.612	positive regulation of biological process
GO:0010556	0.601	regulation of macromolecule biosynthetic process
GO:0048522	0.570	positive regulation of cellular process
GO:0031326	0.570	regulation of cellular biosynthetic process
GO:0051246	0.546	regulation of protein metabolic process
GO:0030182	0.468	neuron differentiation
GO:0048666	0.416	neuron development
GO:0009893	0.415	positive regulation of metabolic process
GO:0010604	0.405	positive regulation of macromolecule metabolic process
GO:2000112	0.362	regulation of cellular macromolecule biosynthetic process
GO:0022037	0.348	metencephalon development
GO:0021549	0.344	cerebellum development
GO:0031325	0.332	positive regulation of cellular metabolic process
GO:0006417	0.308	regulation of translation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043226	0.705	organelle
GO:0043229	0.699	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]