StarFunc result for job id Q5PSV4

User Input

>input (323 residues)
MPVHSRGDKKETNHHDEMEVDYAENEGSSSEDEDTESSSVSEDGDSSEMDDEDCERRRME
CLDEMSNLEKQFTDLKDQLYKERLSQVDAKLQEVIAGKAPEYLEPLATLQENMQIRTKVA
GIYRELCLESVKNKYECEIQASRQHCESEKLLLYDTVQSELEEKIRRLEEDRHSIDITSE
LWNDELQSRKKRKDPFSPDKKKPVVVSGPYIVYMLQDLDILEDWTTIRKAMATLGPHRVK
TEPPVKLEKHLHSARSEEGRLYYDGEWYIRGQTICIDKKDECPTSAVITTINHDEVWFKR
PDGSKSKLYISQLQKGKYSIKHS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5PSV4	1.000	1.000	2.570E-46	323	1.000	1.000	Q5PSV4.pdb.gz	BRM1L_HUMAN Breast cancer metastasis-suppressor 1-like protein OS=Homo sapiens OX=9606 GN=BRMS1L PE=1 SV=2
2	AFDB:Q8BR65	0.317	0.313	7.736E-16	328	0.263	0.259	Q8BR65.pdb.gz	SDS3_MOUSE Sin3 histone deacetylase corepressor complex component SDS3 OS=Mus musculus OX=10090 GN=Suds3 PE=1 SV=1
3	AFDB:Q8MS11	0.344	0.340	2.093E-15	327	0.260	0.257	Q8MS11.pdb.gz	Q8MS11_DROME RE74901p OS=Drosophila melanogaster OX=7227 GN=CG14220 PE=2 SV=1
4	AFDB:Q99N20	0.449	0.576	6.238E-14	246	0.406	0.533	Q99N20.pdb.gz	BRMS1_MOUSE Breast cancer metastasis-suppressor 1 homolog OS=Mus musculus OX=10090 GN=Brms1 PE=2 SV=1
5	AFDB:Q9VYI2	0.405	0.489	7.282E-10	259	0.279	0.347	Q9VYI2.pdb.gz	Q9VYI2_DROME BRMS1 transcriptional repressor OS=Drosophila melanogaster OX=7227 GN=Brms1 PE=1 SV=2
6	AFDB:Q9UTB6	0.293	0.349	1.525E-2	267	0.090	0.109	Q9UTB6.pdb.gz	SDS3_SCHPO Transcriptional regulatory protein sds3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sds3 PE=1 SV=1
7	AFDB:P31385	0.254	0.208	3.669E-2	405	0.155	0.123	P31385.pdb.gz	DEP1_YEAST Transcriptional regulatory protein DEP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DEP1 PE=1 SV=3
8	PDB:3fb9A	0.148	0.493	4.040E-2	89	0.025	0.090	3fb9A.pdb.gz
9	PDB:4zn3A	0.132	0.270	5.106E-2	147	0.037	0.082	4zn3A.pdb.gz	Structural and biochemical insights into the DNA-binding mode of MjSpt4p:Spt5 complex at the exit tunnel of RNAPII
10	PDB:5z8lA	0.122	0.183	8.156E-2	204	0.050	0.078	5z8lA.pdb.gz	EBS is a bivalent histone reader that regulates floral phase transition in Arabidopsis.
11	AFDB:Q585K6	0.222	0.174	9.359E-2	450	0.127	0.091	Q585K6.pdb.gz	Q585K6_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.26G5.180 PE=4 SV=1
12	PDB:4pa0A	0.120	0.043	1.031E-1	974	0.015	0.005	4pa0A.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
13	PDB:4pa0B	0.120	0.045	1.229E-1	920	0.015	0.005	4pa0B.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
14	PDB:7w3ax	0.109	0.075	1.303E-1	494	0.028	0.018	7w3ax.pdb.gz	USP14-regulated allostery of the human proteasome by time-resolved cryo-EM.
15	AFDB:Q92266	0.123	0.109	1.330E-1	380	0.111	0.095	Q92266.pdb.gz	PEX13_PICPA Peroxisomal membrane protein PEX13 OS=Komagataella pastoris OX=4922 GN=PEX13 PE=1 SV=1
16	PDB:6mjpC	0.078	0.107	2.206E-1	174	0.034	0.063	6mjpC.pdb.gz	Structural basis of unidirectional export of lipopolysaccharide to the cell surface.
17	PDB:7kgbC	0.123	0.142	2.206E-1	272	0.043	0.051	7kgbC.pdb.gz	Discovery of natural-product-derived sequanamycins as potent oral anti-tuberculosis agents.
18	PDB:4v8mBe	0.108	0.181	2.339E-1	185	0.028	0.049	4v8mBe.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
19	PDB:5e1lA	0.137	0.242	2.629E-1	173	0.031	0.058	5e1lA.pdb.gz
20	AFDB:Q8NFD8	0.163	0.150	3.392E-1	354	0.139	0.127	Q8NFD8.pdb.gz	Q8NFD8_HUMAN Platelet receptor for type III collagen (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5PSV4	0.0	662	323	1.000	1.000	BRM1L_HUMAN Breast cancer metastasis-suppressor 1-like protein OS=Homo sapiens OX=9606 GN=BRMS1L PE=1 SV=2
2	Q99N20	2.36e-77	238	246	0.412	0.541	BRMS1_MOUSE Breast cancer metastasis-suppressor 1 homolog OS=Mus musculus OX=10090 GN=Brms1 PE=2 SV=1
3	Q9HCU9	3.37e-75	233	246	0.344	0.451	BRMS1_HUMAN Breast cancer metastasis-suppressor 1 OS=Homo sapiens OX=9606 GN=BRMS1 PE=1 SV=1
4	Q9VYI2	1.33e-48	165	259	0.285	0.355	Q9VYI2_DROME BRMS1 transcriptional repressor OS=Drosophila melanogaster OX=7227 GN=Brms1 PE=1 SV=2
5	Q8BR65	1.10e-28	114	328	0.260	0.256	SDS3_MOUSE Sin3 histone deacetylase corepressor complex component SDS3 OS=Mus musculus OX=10090 GN=Suds3 PE=1 SV=1
6	Q9H7L9	1.71e-28	114	328	0.260	0.256	SDS3_HUMAN Sin3 histone deacetylase corepressor complex component SDS3 OS=Homo sapiens OX=9606 GN=SUDS3 PE=1 SV=2
7	Q9VWG2	2.55e-26	108	327	0.279	0.275	Q9VWG2_DROME FI07430p OS=Drosophila melanogaster OX=7227 GN=SDS3 PE=2 SV=1
8	Q8MS11	2.61e-26	108	327	0.279	0.275	Q8MS11_DROME RE74901p OS=Drosophila melanogaster OX=7227 GN=CG14220 PE=2 SV=1
9	P40505	0.12	36.2	327	0.087	0.086	SDS3_YEAST Transcriptional regulatory protein SDS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SDS3 PE=1 SV=1
10	P31385	0.18	35.8	405	0.050	0.040	DEP1_YEAST Transcriptional regulatory protein DEP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DEP1 PE=1 SV=3
11	A0A0B4J1W3	0.52	34.7	865	0.105	0.039	A0A0B4J1W3_HUMAN N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA15 PE=1 SV=1
12	A0A0B4LGD3	1.5	33.1	1077	0.108	0.032	A0A0B4LGD3_DROME Kazachoc, isoform G OS=Drosophila melanogaster OX=7227 GN=kcc PE=1 SV=1
13	A0A0B4LHE0	1.5	33.1	1066	0.108	0.033	A0A0B4LHE0_DROME Kazachoc, isoform F OS=Drosophila melanogaster OX=7227 GN=kcc PE=1 SV=1
14	Q8MLQ5	1.5	33.1	1074	0.108	0.033	Q8MLQ5_DROME Kazachoc, isoform D OS=Drosophila melanogaster OX=7227 GN=kcc PE=1 SV=1
15	Q9W1G5	1.5	33.1	1059	0.108	0.033	Q9W1G5_DROME Kazachoc, isoform C OS=Drosophila melanogaster OX=7227 GN=kcc PE=1 SV=2
16	Q80UM3	2.3	32.7	865	0.102	0.038	NAA15_MOUSE N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Mus musculus OX=10090 GN=Naa15 PE=1 SV=1
17	Q99NH0	3.5	32.0	2603	0.087	0.011	ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus OX=10090 GN=Ankrd17 PE=1 SV=2
18	Q9P7M1	3.6	32.0	491	0.046	0.031	DEP1_SCHPO Transcriptional regulatory protein dep1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dep1 PE=1 SV=1
19	Q9NZV7	3.9	31.6	527	0.071	0.044	ZIM2_HUMAN Zinc finger imprinted 2 OS=Homo sapiens OX=9606 GN=ZIM2 PE=1 SV=1
20	Q9QZ04	4.9	31.6	1284	0.077	0.019	MAGL2_MOUSE MAGE-like protein 2 OS=Mus musculus OX=10090 GN=Magel2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13837 Myb_DNA-bind_4	4.1e+02	12.8	Myb/SANT-like DNA-binding domain
2	PF08598 Sds3	9.7e-18	76.5	Sds3-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 246437.XP_006152432.1

Rank	PPI partner	STRING score	Description
1	246437.XP_006151618.1	0.956	Sin3 histone deacetylase corepressor complex component SDS3
2	246437.XP_006144900.1	0.953	AT-rich interactive domain-containing protein 4A
3	246437.XP_006142640.1	0.934	Paired amphipathic helix protein Sin3a
4	246437.XP_006146026.1	0.926	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred complete CDS: inserted 1 base in 1 codon
5	246437.XP_006147252.1	0.924	SIN3 transcription regulator family member B
6	246437.XP_006158173.1	0.899	Histone deacetylase 1
7	246437.XP_006159709.1	0.891	Inhibitor of growth protein 1
8	246437.XP_006160535.1	0.884	Inhibitor of growth protein 2
9	246437.XP_006157080.1	0.876	Histone deacetylase 2-like isoform X1
10	246437.XP_006165529.1	0.854	PHD finger protein 12
11	246437.XP_006153739.1	0.844	Histone deacetylase complex subunit SAP130
12	246437.XP_006161553.1	0.844	Belongs to the histone deacetylase family. HD Type 1 subfamily
13	246437.XP_006158021.1	0.842	RB binding protein 7, chromatin remodeling factor
14	246437.XP_006168116.1	0.829	Protein FAM60A-like
15	246437.XP_006146539.1	0.811	Sin3A associated protein 30
16	246437.XP_006168033.1	0.802	Histone deacetylase 8
17	246437.XP_006141074.1	0.784	EMSY, BRCA2 interacting transcriptional repressor
18	246437.XP_006165179.1	0.770	Histone deacetylase complex subunit SAP30L
19	246437.XP_006150100.1	0.759	Transcription initiation factor TFIID subunit 3
20	246437.XP_006152293.1	0.756	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred complete CDS: inserted 3 bases in 3 codons

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0048519	0.995	negative regulation of biological process
GO:0051171	0.995	regulation of nitrogen compound metabolic process
GO:0048523	0.992	negative regulation of cellular process
GO:0006355	0.992	regulation of DNA-templated transcription
GO:0045892	0.966	negative regulation of DNA-templated transcription
GO:0048518	0.940	positive regulation of biological process
GO:0048522	0.848	positive regulation of cellular process
GO:0010604	0.695	positive regulation of macromolecule metabolic process
GO:0051173	0.692	positive regulation of nitrogen compound metabolic process
GO:0071704	0.601	organic substance metabolic process
GO:0009987	0.594	cellular process
GO:0044238	0.579	primary metabolic process
GO:0006807	0.534	nitrogen compound metabolic process
GO:0043170	0.487	macromolecule metabolic process
GO:1901564	0.436	organonitrogen compound metabolic process
GO:0010941	0.409	regulation of cell death
GO:0043412	0.403	macromolecule modification
GO:0019538	0.401	protein metabolic process
GO:0043067	0.375	regulation of programmed cell death
GO:0042981	0.361	regulation of apoptotic process
GO:0006357	0.308	regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.986	cytoplasm
GO:0032991	0.945	protein-containing complex
GO:0043232	0.759	intracellular non-membrane-bounded organelle
GO:0005829	0.753	cytosol
GO:0140513	0.729	nuclear protein-containing complex
GO:0070822	0.703	Sin3-type complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]