StarFunc result for job id Q5QGS0

User Input

>input (1516 residues)
MDNQQDKAIVASANGENTLINGVKENDSEDQDVAMKSFAALEAAAPIQPTPVAQKETLMY
PRGLLPLPSKKPCMQSPPSPLGLIEAPEHAANSASVNAISLTSGIAKGLNTWSLPNECEK
APFAIMEPAGMSALNGDCLMQPSRTCLGCFMESKDAVDPEPGISLKVGDLNRDYETCAVS
DIGIQCINAGENMKYGEQLLSDQLLGFPLHKSRAGDRRETEKPDIDLEDPAQKSYYEALL
LDKCNTEEALLANSNQDWGYFETFISESKIELLDLCSKNELSVNLFSEEDVDNYMFDDDE
STLGSDVCSLKIRYESFQDNVRDKTTLLMQEDAQFNFFPSVFTTCPKRESKSGALKQSSD
FSQFKVPDVSIIWGEEDKNLDKKKGKEEGQEDKGVEKKDGKDNGEKPALNKPCSGTEVEQ
LKNPKQGHLANSLETSGSFSDDSSFIEISYDAMGEIKDCSRYMARDTNSGSSSSQQNYGL
RAKRKVRYSEDYLYDVDSLEGEKVNERKEWLPVGSKEEDDDEWCPKKRRKVTRKEPPVII
KYIIINRFKGEKNMLVKLGKVDASETTVNLSENQLNKYAKLAPLKGFWQKKKKQRNTNTD
SIKTPFSQKQSFEPGSFEVSFLPPARKRKSKLGNRHRIQRIPSIEISASSKQISLCNDQR
HASNHKEDGGLKGTLKSAPLGAPSCANGSHLNDITGPDSVKVKAQDTEFKGPERKVLNKI
KFKSEARLKSKKVKAAGQESKPIVQMSPLLENQSSKANLKNEVIPGTSNSSRLSEFHEAK
AAKSSTFLPTTCSSEMPLSSANVTTNIPVIPGGYLQTLLDASDLSNNTSISYFSHHSPEQ
NEGSLTQTEKSFVPLQPTQDCVLTSSSDSELQQSSHNFKMESSNYRNVWPNKATSGTQEF
MAEVSREIAPTQSSEFGASQVVSMENNLTPTTYNPICLNSGGSNCNKVLYDSMQDTQLPS
DDSYQLCHFNNGEICFPFQQGPVNMDDGRLFSFDSMAPLSVSSSNYCSLSLKSCEKDGDD
DITDDFLAHCSPKLVIQQSIDEIAPLKESTDLLDISNFTPDKFRHSSLSEMSPPDTPSLS
PQITRCESMKTLGTLKGFQEGVPGPLDSVEKIKWDCSTLSRQVQMEDGFTLNNHQFQFHM
FNDEDSVSLLQKNPCLSTFNDPSGQISTNNKVSKSRKKSSPSKSGAMNQSSSQKNTRKKS
LKGNNKGIEKPPGKNSRQVPKSTKKGKYMAAINGEKMQIGIGRGGSQTNTISSTGKTLAE
CIQHGGPMASMKMPSQKGLSGDWALGKESSPGWSDMSMGTNTNSLLDDDQREFQEPSYIL
SNIASGMADVQRFMMASIEPLWEPMEHHGDPNIFYSPESNSLKLKTLKILAGTPQESKKK
INSGSQGATKNHRSIKGVSKSNGKTAIGDPGRANMPGYNEDSRSTFFDKKYSNMSTLGNN
GPTHKKLYRHKSSSKALRDEKCKGKHMEREQVHKDESGTASFEKLRDSDYNLLKAETTFW
VLPVFEEETRIFQKDI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZGX1	0.189	0.189	0.000	1517	0.865	0.865	D3ZGX1.pdb.gz	NEXMI_RAT Neurite extension and migration factor OS=Rattus norvegicus OX=10116 GN=Nexmif PE=1 SV=1
2	AFDB:Q5QGS0	1.000	1.000	0.000	1516	1.000	1.000	Q5QGS0.pdb.gz	NEXMI_HUMAN Neurite extension and migration factor OS=Homo sapiens OX=9606 GN=NEXMIF PE=1 SV=1
3	AFDB:Q6ZU65	0.034	0.037	6.729E-8	1347	0.154	0.173	Q6ZU65.pdb.gz	UBN2_HUMAN Ubinuclein-2 OS=Homo sapiens OX=9606 GN=UBN2 PE=1 SV=2
4	AFDB:Q8IY92	0.042	0.037	3.116E-6	1834	0.146	0.121	Q8IY92.pdb.gz	SLX4_HUMAN Structure-specific endonuclease subunit SLX4 OS=Homo sapiens OX=9606 GN=SLX4 PE=1 SV=3
5	AFDB:A0A2R8QMX9	0.038	0.040	8.422E-6	1443	0.147	0.155	A0A2R8QMX9.pdb.gz
6	AFDB:Q6P5H2	0.040	0.034	8.422E-6	1864	0.133	0.108	Q6P5H2.pdb.gz	NEST_MOUSE Nestin OS=Mus musculus OX=10090 GN=Nes PE=1 SV=1
7	AFDB:P20482	0.036	0.038	4.314E-5	1383	0.139	0.153	P20482.pdb.gz	CNC_DROME Segmentation protein cap'n'collar OS=Drosophila melanogaster OX=7227 GN=cnc PE=2 SV=3
8	AFDB:Q6PAC4	0.039	0.044	1.012E-4	1279	0.121	0.143	Q6PAC4.pdb.gz	PCARE_MOUSE Photoreceptor cilium actin regulator OS=Mus musculus OX=10090 GN=Pcare PE=2 SV=1
9	AFDB:P35658	0.036	0.029	1.166E-4	2090	0.157	0.114	P35658.pdb.gz	NU214_HUMAN Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214 PE=1 SV=2
10	AFDB:A6NGG8	0.032	0.036	1.443E-4	1288	0.130	0.153	A6NGG8.pdb.gz	PCARE_HUMAN Photoreceptor cilium actin regulator OS=Homo sapiens OX=9606 GN=PCARE PE=1 SV=1
11	PDB:7ung7	0.018	0.092	3.418	146	0.011	0.116	7ung7.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
12	PDB:3j6b2	0.026	0.204	3.940	113	0.013	0.168	3j6b2.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
13	PDB:7qsdb	0.028	0.200	7.465	83	0.010	0.181	7qsdb.pdb.gz	Structural basis of mammalian respiratory complex I inhibition by medicinal biguanides.
14	PDB:6fvtN	0.024	0.035	8.015	922	0.009	0.015	6fvtN.pdb.gz	Expanded Coverage of the 26S Proteasome Conformational Landscape Reveals Mechanisms of Peptidase Gating.
15	PDB:7ajtCK	0.018	0.120	8.605	207	0.013	0.097	7ajtCK.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
16	PDB:7rro7	0.017	0.134	8.605	121	0.011	0.132	7rro7.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8YEQ5	0.0	3073	1486	0.980	1.000	A0A2R8YEQ5_HUMAN Neurite extension and migration factor OS=Homo sapiens OX=9606 GN=NEXMIF PE=1 SV=1
2	D3ZGX1	0.0	2648	1517	0.865	0.865	NEXMI_RAT Neurite extension and migration factor OS=Rattus norvegicus OX=10116 GN=Nexmif PE=1 SV=1
3	Q5QGS0	0.0	3135	1516	1.000	1.000	NEXMI_HUMAN Neurite extension and migration factor OS=Homo sapiens OX=9606 GN=NEXMIF PE=1 SV=1
4	O60673	1.98e-26	121	3130	0.070	0.034	REV3L_HUMAN DNA polymerase zeta catalytic subunit OS=Homo sapiens OX=9606 GN=REV3L PE=1 SV=2
5	Q61493	1.00e-24	115	3122	0.070	0.034	REV3L_MOUSE DNA polymerase zeta catalytic subunit OS=Mus musculus OX=10090 GN=Rev3l PE=1 SV=3
6	P18339	1.5	35.8	1609	0.022	0.021	RDRP_TMGMV Replicase large subunit OS=Tobacco mild green mosaic virus OX=12241 PE=1 SV=2
7	Q91YJ5	3.3	34.7	727	0.015	0.032	IF2M_MOUSE Translation initiation factor IF-2, mitochondrial OS=Mus musculus OX=10090 GN=Mtif2 PE=1 SV=2
8	O15037	8.4	33.5	678	0.014	0.031	KHNYN_HUMAN Protein KHNYN OS=Homo sapiens OX=9606 GN=KHNYN PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15735 DUF4683	2.7e-115	397.9	Domain of unknown function (DUF4683)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000055682

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000370697	0.900	P2Y purinoceptor 8
2	9606.ENSP00000253401	0.757	Rho guanine nucleotide exchange factor 9
3	9606.ENSP00000364054	0.747	Spindlin-3
4	9606.ENSP00000328059	0.707	E3 ubiquitin-protein ligase RLIM
5	9606.ENSP00000365606	0.703	GRIP1-associated protein 1
6	9606.ENSP00000427329	0.698	Forkhead box R2
7	9606.ENSP00000362465	0.697	Palmitoyltransferase ZDHHC15
8	9606.ENSP00000365256	0.695	H(+)/Cl(-) exchange transporter 5
9	9606.ENSP00000329117	0.684	APC membrane recruitment protein 1
10	9606.ENSP00000218249	0.677	Ras-related protein Rab-40A-like
11	9606.ENSP00000465734	0.647	Monocarboxylate transporter 8
12	9606.ENSP00000480158	0.642	DNA-directed RNA polymerase II subunit RPB1
13	9606.ENSP00000262839	0.624	Short transient receptor potential channel 5
14	9606.ENSP00000354912	0.602	Melanoma-associated antigen E1
15	9606.ENSP00000253577	0.599	ATP-binding cassette sub-family B member 7, mitochondrial
16	9606.ENSP00000360017	0.599	Zinc finger protein 280C
17	9606.ENSP00000281456	0.589	ADP/ATP translocase 1
18	9606.ENSP00000377699	0.574	Adhesion G-protein coupled receptor G4
19	9606.ENSP00000362390	0.565	T-box transcription factor TBX22
20	9606.ENSP00000345029	0.526	Protein FAM47A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.725	organic cyclic compound binding
GO:1901363	0.724	heterocyclic compound binding
GO:0003824	0.316	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.988	regulation of biological process
GO:0050794	0.976	regulation of cellular process
GO:0009987	0.716	cellular process
GO:0048523	0.690	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005654	0.999	nucleoplasm
GO:0043232	0.987	intracellular non-membrane-bounded organelle
GO:0005856	0.888	cytoskeleton
GO:0015630	0.811	microtubule cytoskeleton
GO:0005819	0.706	spindle
GO:0072686	0.684	mitotic spindle
GO:0030496	0.681	midbody
GO:0016020	0.513	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]