StarFunc result for job id Q5QP82

User Input

>input (559 residues)
MFPFGPHSPGGDGSAGAGAEEPTPHEGQAAATGPPSPLHPGADATHPPPPARSPRRPGAP
SLSPAPRSGELGLPGAPESSTASAPGEPSPPSPPCRRPGPDCRAKSRGRHGLGAGLGGPG
ARLFGWLKERSLGRGLFVDPARDNFRTMTSLYGSIHPADSVYLSTRTHGAVFNLEYSPDG
SVLTVACEQTEVLLFDPISSKHIKTLSEAHEDCVNNIRFLDNRLFATCSDDTTIALWDLR
KLNTKVCTLHGHTSWVKNIEYDTNTRLLVTSGFDGNVIIWDTNRYTEDGCPHKKFFHTRF
LMRMRLTPDCSKMLISTSSGYLLILHDLDLTKSLEVGSYPILRARRTTSSSDLTTSSSSS
GPRVSGSPCHHSDSNSSEKHMSRASQREGVSPRNSLEVVTPEVLGESDHGNCITSLQLHP
KGWATLLRCSSNSDDEECTCVYEFQEGAPVRPVSPRCSLRLTHYIEEANVGRGYIKELCF
SPDGRMISSPHGYGIRLLGFDKQCSELVDCLPKEASPLRVIRSLYSHNDVVLTTKFSPTH
CQIASGCLSGRVSLYQPKF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5QP82	1.000	1.000	0.000	559	1.000	1.000	Q5QP82.pdb.gz	DCA10_HUMAN DDB1- and CUL4-associated factor 10 OS=Homo sapiens OX=9606 GN=DCAF10 PE=1 SV=1
2	AFDB:Q23256	0.477	0.529	1.433E-18	501	0.165	0.184	Q23256.pdb.gz	WDR53_CAEEL WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans OX=6239 GN=wdr-5.3 PE=3 SV=1
3	AFDB:O48847	0.453	0.328	3.606E-18	787	0.145	0.103	O48847.pdb.gz	LUH_ARATH Transcriptional corepressor LEUNIG_HOMOLOG OS=Arabidopsis thaliana OX=3702 GN=LUH PE=1 SV=1
4	AFDB:Q9FUY2	0.460	0.285	9.883E-17	931	0.154	0.092	Q9FUY2.pdb.gz	LEUNG_ARATH Transcriptional corepressor LEUNIG OS=Arabidopsis thaliana OX=3702 GN=LUG PE=1 SV=2
5	AFDB:F4JUD2	0.460	0.274	1.163E-16	969	0.156	0.090	F4JUD2.pdb.gz	F4JUD2_ARATH Transcriptional corepressor LEUNIG OS=Arabidopsis thaliana OX=3702 GN=LUG PE=1 SV=1
6	AFDB:Q7KNS3	0.439	0.585	2.001E-16	411	0.109	0.148	Q7KNS3.pdb.gz	LIS1_DROME Lissencephaly-1 homolog OS=Drosophila melanogaster OX=7227 GN=Lis-1 PE=1 SV=2
7	PDB:2h9lA	0.453	0.761	2.193E-16	321	0.127	0.221	2h9lA.pdb.gz
8	AFDB:A0AV58	0.448	0.357	7.774E-16	713	0.161	0.126	A0AV58.pdb.gz	A0AV58_HUMAN Striatin, calmodulin binding protein 3 OS=Homo sapiens OX=9606 GN=STRN3 PE=2 SV=1
9	PDB:5mzhB	0.422	0.551	1.821E-15	415	0.095	0.128	5mzhB.pdb.gz
10	AFDB:Q64LD2	0.458	0.469	2.709E-15	544	0.156	0.160	Q64LD2.pdb.gz	WDR25_HUMAN WD repeat-containing protein 25 OS=Homo sapiens OX=9606 GN=WDR25 PE=1 SV=3
11	AFDB:Q95RJ9	0.421	0.345	5.792E-15	700	0.150	0.120	Q95RJ9.pdb.gz	EBI_DROME F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster OX=7227 GN=ebi PE=1 SV=2
12	PDB:5nnzA	0.426	0.673	8.323E-15	335	0.093	0.155	5nnzA.pdb.gz
13	AFDB:A0A087WT20	0.430	0.404	1.111E-14	597	0.150	0.141	A0A087WT20.pdb.gz	A0A087WT20_HUMAN DDB1- and CUL4-associated factor 13 OS=Homo sapiens OX=9606 GN=DCAF13 PE=1 SV=1
14	PDB:3sfzA	0.443	0.228	2.211E-14	1133	0.106	0.052	3sfzA.pdb.gz	Crystal structure of full-length Apaf-1: how the death signal is relayed in the mitochondrial pathway of apoptosis.
15	PDB:5mqfF	0.466	0.818	2.747E-14	307	0.114	0.208	5mqfF.pdb.gz	Cryo-EM structure of a human spliceosome activated for step 2 of splicing.
16	PDB:3jcmB	0.463	0.592	3.413E-14	429	0.093	0.121	3jcmB.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
17	PDB:6bk8M	0.431	0.708	4.017E-14	326	0.089	0.153	6bk8M.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
18	PDB:7ajtUO	0.444	0.499	4.241E-14	493	0.095	0.108	7ajtUO.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
19	PDB:6id0W	0.467	0.509	6.912E-14	509	0.097	0.106	6id0W.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
20	PDB:5yzgW	0.451	0.564	9.067E-14	440	0.084	0.107	5yzgW.pdb.gz	Structure of a human catalytic step I spliceosome

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5QP82	0.0	1140	559	1.000	1.000	DCA10_HUMAN DDB1- and CUL4-associated factor 10 OS=Homo sapiens OX=9606 GN=DCAF10 PE=1 SV=1
2	Q54KL5	1.46e-11	68.2	335	0.100	0.167	WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum OX=44689 GN=wdr5 PE=3 SV=1
3	C6KRL4	3.16e-09	62.0	563	0.061	0.060	C6KRL4_CAEEL DDB1- and CUL4-associated factor 11 homolog OS=Caenorhabditis elegans OX=6239 GN=wdr-23 PE=3 SV=1
4	P90794	3.28e-09	62.0	571	0.061	0.060	DCA11_CAEEL DDB1- and CUL4-associated factor 11 homolog OS=Caenorhabditis elegans OX=6239 GN=wdr-23 PE=3 SV=1
5	Q6NLV4	6.69e-09	60.8	647	0.109	0.094	FY_ARATH Flowering time control protein FY OS=Arabidopsis thaliana OX=3702 GN=FY PE=1 SV=1
6	F4K3Y7	1.11e-08	60.5	657	0.106	0.090	F4K3Y7_ARATH Transducin/WD40 repeat-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=FY PE=1 SV=2
7	Q3E906	1.53e-08	59.3	450	0.079	0.098	CD205_ARATH Cell division cycle 20.5, cofactor of APC complex OS=Arabidopsis thaliana OX=3702 GN=CDC20-5 PE=1 SV=3
8	O22469	1.67e-08	59.3	424	0.068	0.090	MSI3_ARATH WD-40 repeat-containing protein MSI3 OS=Arabidopsis thaliana OX=3702 GN=MSI3 PE=1 SV=2
9	Q9BQ67	1.72e-08	59.3	446	0.088	0.110	GRWD1_HUMAN Glutamate-rich WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=GRWD1 PE=1 SV=1
10	O14021	3.17e-08	58.5	431	0.055	0.072	PRW1_SCHPO RbAp48-related WD40 repeat-containing protein prw1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prw1 PE=1 SV=1
11	O74855	3.32e-08	58.5	502	0.064	0.072	NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rsa4 PE=3 SV=1
12	Q38C57	4.37e-08	58.2	433	0.064	0.083	Q38C57_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.5990 PE=4 SV=1
13	Q5JKX0	1.52e-07	56.6	527	0.064	0.068	Q5JKX0_ORYSJ Putative FY protein OS=Oryza sativa subsp. japonica OX=39947 GN=B1147A04.35 PE=2 SV=1
14	A0MNP2	1.56e-07	55.8	357	0.066	0.104	A0MNP2_HUMAN CDW11/WDR57 OS=Homo sapiens OX=9606 GN=WDR57 PE=2 SV=1
15	Q96DI7	1.56e-07	55.8	357	0.066	0.104	SNR40_HUMAN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens OX=9606 GN=SNRNP40 PE=1 SV=1
16	Q57YK0	1.76e-07	56.6	638	0.059	0.052	Q57YK0_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.11J15.880 PE=4 SV=1
17	Q8T088	1.97e-07	56.2	498	0.066	0.074	WDR55_DROME WD repeat-containing protein 55 homolog OS=Drosophila melanogaster OX=7227 GN=CG14722 PE=2 SV=1
18	D6QUQ2	2.33e-07	55.8	463	0.066	0.080	D6QUQ2_9CNID Poc1 OS=Clytia hemisphaerica OX=252671 PE=2 SV=1
19	Q6DRF9	4.01e-07	54.7	387	0.055	0.080	WDR55_DANRE WD repeat-containing protein 55 OS=Danio rerio OX=7955 GN=wdr55 PE=2 SV=2
20	Q9S7H3	4.12e-07	55.1	442	0.070	0.088	CD203_ARATH Cell division cycle 20.3, cofactor of APC complex OS=Arabidopsis thaliana OX=3702 GN=CDC20-3 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	7.8e-05	34.2	Anaphase-promoting complex subunit 4 WD40 domain
2	PF16529 Ge1_WD40	5.6e+02	10.9	WD40 region of Ge1, enhancer of mRNA-decapping protein
3	PF20426 NBCH_WD40	31	14.8	Neurobeachin beta propeller domain
4	PF00400 WD40	1.6e-10	52.5	WD domain, G-beta repeat
5	PF17005 WD40_like	42	14.9	WD40-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000366953

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000301764	0.979	DNA damage-binding protein 1
2	9606.ENSP00000384109	0.960	Cullin-4B
3	9606.ENSP00000364589	0.951	Cullin-4A
4	9606.ENSP00000351147	0.940	DDB1- and CUL4-associated factor 4
5	9606.ENSP00000438115	0.940	COP9 signalosome complex subunit 7a
6	9606.ENSP00000356814	0.939	DDB1- and CUL4-associated factor 6
7	9606.ENSP00000264515	0.927	Retinoblastoma-binding protein 5
8	9606.ENSP00000304102	0.927	COP9 signalosome complex subunit 6
9	9606.ENSP00000256996	0.925	DNA damage-binding protein 2
10	9606.ENSP00000352928	0.925	DET1- and DDB1-associated protein 1
11	9606.ENSP00000451235	0.925	DDB1- and CUL4-associated factor 8
12	9606.ENSP00000393183	0.921	DDB1- and CUL4-associated factor 1
13	9606.ENSP00000317971	0.918	WD and tetratricopeptide repeats protein 1
14	9606.ENSP00000456340	0.918	DET1 homolog
15	9606.ENSP00000264389	0.911	COP9 signalosome complex subunit 4
16	9606.ENSP00000351446	0.909	WD repeat-containing protein 5
17	9606.ENSP00000357052	0.909	DDB1- and CUL4-associated factor 8
18	9606.ENSP00000415556	0.909	DDB1- and CUL4-associated factor 11
19	9606.ENSP00000299259	0.908	COP9 signalosome complex subunit 2
20	9606.ENSP00000265038	0.906	DNA excision repair protein ERCC-8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.361	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0044238	0.987	primary metabolic process
GO:0065007	0.985	biological regulation
GO:0071704	0.981	organic substance metabolic process
GO:0050789	0.978	regulation of biological process
GO:0050794	0.974	regulation of cellular process
GO:0006807	0.922	nitrogen compound metabolic process
GO:0043170	0.862	macromolecule metabolic process
GO:1901564	0.789	organonitrogen compound metabolic process
GO:0044237	0.587	cellular metabolic process
GO:0019538	0.552	protein metabolic process
GO:0019222	0.479	regulation of metabolic process
GO:0048518	0.420	positive regulation of biological process
GO:0031323	0.413	regulation of cellular metabolic process
GO:0080090	0.373	regulation of primary metabolic process
GO:0051171	0.370	regulation of nitrogen compound metabolic process
GO:0060255	0.355	regulation of macromolecule metabolic process
GO:0048522	0.315	positive regulation of cellular process
GO:0044260	0.313	cellular macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:1902494	0.995	catalytic complex
GO:0031461	0.987	cullin-RING ubiquitin ligase complex
GO:0080008	0.971	Cul4-RING E3 ubiquitin ligase complex
GO:0005737	0.736	cytoplasm
GO:0005829	0.654	cytosol
GO:0043232	0.312	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]