StarFunc result for job id Q5S007

User Input

>input (2527 residues)
MASGSCQGCEEDEETLKKLIVRLNNVQEGKQIETLVQILEDLLVFTYSERASKLFQGKNI
HVPLLIVLDSYMRVASVQQVGWSLLCKLIEVCPGTMQSLMGPQDVGNDWEVLGVHQLILK
MLTVHNASVNLSVIGLKTLDLLLTSGKITLLILDEESDIFMLIFDAMHSFPANDEVQKLG
CKALHVLFERVSEEQLTEFVENKDYMILLSALTNFKDEEEIVLHVLHCLHSLAIPCNNVE
VLMSGNVRCYNIVVEAMKAFPMSERIQEVSCCLLHRLTLGNFFNILVLNEVHEFVVKAVQ
QYPENAALQISALSCLALLTETIFLNQDLEEKNENQENDDEGEEDKLFWLEACYKALTWH
RKNKHVQEAACWALNNLLMYQNSLHEKIGDEDGHFPAHREVMLSMLMHSSSKEVFQASAN
ALSTLLEQNVNFRKILLSKGIHLNVLELMQKHIHSPEVAESGCKMLNHLFEGSNTSLDIM
AAVVPKILTVMKRHETSLPVQLEALRAILHFIVPGMPEESREDTEFHHKLNMVKKQCFKN
DIHKLVLAALNRFIGNPGIQKCGLKVISSIVHFPDALEMLSLEGAMDSVLHTLQMYPDDQ
EIQCLGLSLIGYLITKKNVFIGTGHLLAKILVSSLYRFKDVAEIQTKGFQTILAILKLSA
SFSKLLVHHSFDLVIFHQMSSNIMEQKDQQFLNLCCKCFAKVAMDDYLKNVMLERACDQN
NSIMVECLLLLGADANQAKEGSSLICQVCEKESSPKLVELLLNSGSREQDVRKALTISIG
KGDSQIISLLLRRLALDVANNSICLGGFCIGKVEPSWLGPLFPDKTSNLRKQTNIASTLA
RMVIRYQMKSAVEEGTASGSDGNFSEDVLSKFDEWTFIPDSSMDSVFAQSDDLDSEGSEG
SFLVKKKSNSISVGEFYRDAVLQRCSPNLQRHSNSLGPIFDHEDLLKRKRKILSSDDSLR
SSKLQSHMRHSDSISSLASEREYITSLDLSANELRDIDALSQKCCISVHLEHLEKLELHQ
NALTSFPQQLCETLKSLTHLDLHSNKFTSFPSYLLKMSCIANLDVSRNDIGPSVVLDPTV
KCPTLKQFNLSYNQLSFVPENLTDVVEKLEQLILEGNKISGICSPLRLKELKILNLSKNH
ISSLSENFLEACPKVESFSARMNFLAAMPFLPPSMTILKLSQNKFSCIPEAILNLPHLRS
LDMSSNDIQYLPGPAHWKSLNLRELLFSHNQISILDLSEKAYLWSRVEKLHLSHNKLKEI
PPEIGCLENLTSLDVSYNLELRSFPNEMGKLSKIWDLPLDELHLNFDFKHIGCKAKDIIR
FLQQRLKKAVPYNRMKLMIVGNTGSGKTTLLQQLMKTKKSDLGMQSATVGIDVKDWPIQI
RDKRKRDLVLNVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKA
RASSSPVILVGTHLDVSDEKQRKACMSKITKELLNKRGFPAIRDYHFVNATEESDALAKL
RKTIINESLNFKIRDQLVVGQLIPDCYVELEKIILSERKNVPIEFPVIDRKRLLQLVREN
QLQLDENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEPKWLCKIMAQILTVKVEGCPK
HPKGIISRRDVEKFLSKKRKFPKNYMSQYFKLLEKFQIALPIGEEYLLVPSSLSDHRPVI
ELPHCENSEIIIRLYEMPYFPMGFWSRLINRLLEISPYMLSGRERALRPNRMYWRQGIYL
NWSPEAYCLVGSEVLDNHPESFLKITVPSCRKGCILLGQVVDHIDSLMEEWFPGLLEIDI
CGEGETLLKKWALYSFNDGEEHQKILLDDLMKKAEEGDLLVNPDQPRLTIPISQIAPDLI
LADLPRNIMLNNDELEFEQAPEFLLGDGSFGSVYRAAYEGEEVAVKIFNKHTSLRLLRQE
LVVLCHLHHPSLISLLAAGIRPRMLVMELASKGSLDRLLQQDKASLTRTLQHRIALHVAD
GLRYLHSAMIIYRDLKPHNVLLFTLYPNAAIIAKIADYGIAQYCCRMGIKTSEGTPGFRA
PEVARGNVIYNQQADVYSFGLLLYDILTTGGRIVEGLKFPNEFDELEIQGKLPDPVKEYG
CAPWPMVEKLIKQCLKENPQERPTSAQVFDILNSAELVCLTRRILLPKNVIVECMVATHH
NSRNASIWLGCGHTDRGQLSFLDLNTEGYTSEEVADSRILCLALVHLPVEKESWIVSGTQ
SGTLLVINTEDGKKRHTLEKMTDSVTCLYCNSFSKQSKQKNFLLVGTADGKLAIFEDKTV
KLKGAAPLKILNIGNVSTPLMCLSESTNSTERNVMWGGCGTKIFSFSNDFTIQKLIETRT
SQLFSYAAFSDSNIITVVVDTALYIAKQNSPVVEVWDKKTEKLCGLIDCVHFLREVMVKE
NKESKHKMSYSGRVKTLCLQKNTALWIGTGGGHILLLDLSTRRLIRVIYNFCNSVRVMMT
AQLGSLKNVMLVLGYNRKNTEGTQKQKEIQSCLTVWDINLPHEVQNLEKHIEVRKELAEK
MRRTSVE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7lhwA	0.401	0.532	0.000	1813	0.715	0.997	7lhwA.pdb.gz	Structural analysis of the full-length human LRRK2.
2	AFDB:Q5S006	0.838	0.838	0.000	2527	0.866	0.866	Q5S006.pdb.gz	LRRK2_MOUSE Leucine-rich repeat serine/threonine-protein kinase 2 OS=Mus musculus OX=10090 GN=Lrrk2 PE=1 SV=2
3	AFDB:Q5S007	1.000	1.000	0.000	2527	1.000	1.000	Q5S007.pdb.gz	LRRK2_HUMAN Leucine-rich repeat serine/threonine-protein kinase 2 OS=Homo sapiens OX=9606 GN=LRRK2 PE=1 SV=2
4	PDB:6xr4A	0.328	0.695	5.767E-79	1040	0.396	0.963	6xr4A.pdb.gz
5	AFDB:Q8MVR1	0.270	0.261	3.147E-35	2631	0.102	0.098	Q8MVR1.pdb.gz	GBPC_DICDI Cyclic GMP-binding protein C OS=Dictyostelium discoideum OX=44689 GN=gbpC PE=1 SV=1
6	PDB:7tvfD	0.110	0.432	4.932E-9	515	0.038	0.184	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
7	PDB:1k9aB	0.106	0.536	5.104E-9	441	0.039	0.222	1k9aB.pdb.gz
8	PDB:8dksA	0.085	0.664	6.946E-9	283	0.029	0.258	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
9	PDB:2h8hA	0.091	0.466	2.928E-8	445	0.036	0.204	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
10	AFDB:O73613	0.094	0.373	2.938E-8	616	0.031	0.127	O73613.pdb.gz	O73613_XENLA Mitogen-activated protein kinase kinase kinase 7 OS=Xenopus laevis OX=8355 GN=map3k7.L PE=2 SV=1
11	PDB:2qkwB	0.096	0.737	3.135E-8	292	0.028	0.247	2qkwB.pdb.gz
12	PDB:6rlbD	0.112	0.554	5.613E-8	446	0.023	0.128	6rlbD.pdb.gz
13	PDB:5ufuA	0.089	0.569	6.661E-8	369	0.033	0.228	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
14	PDB:4rerA	0.086	0.449	7.640E-8	459	0.030	0.166	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
15	AFDB:Q96PE2	0.120	0.145	3.018E-7	2063	0.029	0.036	Q96PE2.pdb.gz	ARHGH_HUMAN Rho guanine nucleotide exchange factor 17 OS=Homo sapiens OX=9606 GN=ARHGEF17 PE=1 SV=1
16	AFDB:Q5UIP0	0.103	0.105	3.123E-7	2472	0.052	0.053	Q5UIP0.pdb.gz	RIF1_HUMAN Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2
17	AFDB:Q24145	0.094	0.243	5.987E-7	939	0.030	0.081	Q24145.pdb.gz	SHARK_DROME Tyrosine-protein kinase Shark OS=Drosophila melanogaster OX=7227 GN=Shark PE=1 SV=2
18	AFDB:Q389F7	0.101	0.226	7.105E-7	1105	0.022	0.051	Q389F7.pdb.gz	Q389F7_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.26.0030 PE=4 SV=1
19	AFDB:O54967	0.099	0.219	8.149E-7	1055	0.032	0.076	O54967.pdb.gz	ACK1_MOUSE Activated CDC42 kinase 1 OS=Mus musculus OX=10090 GN=Tnk2 PE=1 SV=2
20	AFDB:F7BN18	0.098	0.214	1.001E-6	1128	0.033	0.074	F7BN18.pdb.gz	F7BN18_XENTR Tyrosine-protein kinase OS=Xenopus tropicalis OX=8364 GN=abl1 PE=3 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6GFN0	0.0	4386	2477	0.847	0.864	A0A8I6GFN0_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Lrrk2 PE=4 SV=1
2	B4F7C3	0.0	658	379	0.122	0.815	B4F7C3_RAT Lrrk2 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Lrrk2 PE=2 SV=1
3	F1LNJ1	0.0	4512	2526	0.866	0.866	F1LNJ1_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Lrrk2 PE=1 SV=3
4	Q17RV3	0.0	5195	2527	0.999	0.999	Q17RV3_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=LRRK2 PE=2 SV=1
5	Q5BJM3	0.0	570	320	0.106	0.841	Q5BJM3_RAT Lrrk2 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Lrrk2 PE=2 SV=1
6	Q5S006	0.0	4500	2527	0.867	0.867	LRRK2_MOUSE Leucine-rich repeat serine/threonine-protein kinase 2 OS=Mus musculus OX=10090 GN=Lrrk2 PE=1 SV=2
7	Q5S007	0.0	5202	2527	1.000	1.000	LRRK2_HUMAN Leucine-rich repeat serine/threonine-protein kinase 2 OS=Homo sapiens OX=9606 GN=LRRK2 PE=1 SV=2
8	Q3UHC2	1.75e-121	431	2014	0.156	0.195	LRRK1_MOUSE Leucine-rich repeat serine/threonine-protein kinase 1 OS=Mus musculus OX=10090 GN=Lrrk1 PE=1 SV=1
9	Q38SD2	8.67e-118	420	2015	0.153	0.192	LRRK1_HUMAN Leucine-rich repeat serine/threonine-protein kinase 1 OS=Homo sapiens OX=9606 GN=LRRK1 PE=1 SV=3
10	Q55E58	2.33e-84	313	3184	0.128	0.102	PATS1_DICDI Probable serine/threonine-protein kinase pats1 OS=Dictyostelium discoideum OX=44689 GN=pats1 PE=3 SV=1
11	Q9VDJ9	5.68e-52	206	2445	0.066	0.069	Q9VDJ9_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=Lrrk PE=2 SV=3
12	A0A0B4KHT3	5.78e-52	206	2513	0.066	0.067	A0A0B4KHT3_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=Lrrk PE=4 SV=1
13	A0A0B4KH16	6.41e-52	206	2422	0.066	0.069	A0A0B4KH16_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=Lrrk PE=4 SV=1
14	Q8MVR1	4.97e-50	199	2631	0.101	0.097	GBPC_DICDI Cyclic GMP-binding protein C OS=Dictyostelium discoideum OX=44689 GN=gbpC PE=1 SV=1
15	Q9TZM3	9.02e-45	182	2393	0.066	0.070	LRK1_CAEEL Leucine-rich repeat serine/threonine-protein kinase 1 OS=Caenorhabditis elegans OX=6239 GN=lrk-1 PE=1 SV=6
16	Q1ZXD6	3.49e-44	180	2800	0.068	0.061	ROCO5_DICDI Probable serine/threonine-protein kinase roco5 OS=Dictyostelium discoideum OX=44689 GN=roco5 PE=3 SV=1
17	Q55GE6	1.39e-37	159	2615	0.070	0.067	ROCO7_DICDI Probable serine/threonine-protein kinase roco7 OS=Dictyostelium discoideum OX=44689 GN=roco7 PE=3 SV=1
18	Q8KC98	4.24e-29	130	1102	0.081	0.186	Q8KC98_CHLTE Rab family protein OS=Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) OX=194439 GN=CT1526 PE=1 SV=1
19	Q6XHB2	9.92e-29	129	1726	0.058	0.085	ROCO4_DICDI Probable serine/threonine-protein kinase roco4 OS=Dictyostelium discoideum OX=44689 GN=roco4 PE=1 SV=1
20	Q54RB7	6.21e-27	120	527	0.033	0.159	SHKA_DICDI Dual specificity protein kinase shkA OS=Dictyostelium discoideum OX=44689 GN=shkA PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	1.1e+02	14.6	AAA ATPase domain
2	PF13401 AAA_22	18	17.0	AAA domain
3	PF13476 AAA_23	2.5e+02	13.6	AAA domain
4	PF13555 AAA_29	2.4e+02	12.9	P-loop containing region of AAA domain
5	PF13671 AAA_33	3.7e+02	12.7	AAA domain
6	PF12775 AAA_7	20	16.2	P-loop containing dynein motor region
7	PF00005 ABC_tran	9	18.3	ABC transporter
8	PF12796 Ank_2	1.4	20.9	Ankyrin repeats (3 copies)
9	PF00025 Arf	0.042	24.8	ADP-ribosylation factor family
10	PF00514 Arm	9.9e+02	11.2	Armadillo/beta-catenin-like repeat
11	PF00006 ATP-synt_ab	1.2e+02	13.8	ATP synthase alpha/beta family, nucleotide-binding domain
12	PF02492 cobW	88	14.1	CobW/HypB/UreG, nucleotide-binding domain
13	PF16095 COR	1.8e-23	94.9	C-terminal of Roc, COR, domain
14	PF01580 FtsK_SpoIIIE	1.5e+02	13.2	FtsK/SpoIIIE family
15	PF00503 G-alpha	1.2e+02	13.3	G-protein alpha subunit
16	PF04670 Gtr1_RagA	65	14.4	Gtr1/RagA G protein conserved region
17	PF06293 Kdo	69	14.3	Lipopolysaccharide kinase (Kdo/WaaP) family
18	PF12799 LRR_4	2.8e-21	86.4	Leucine Rich repeats (2 copies)
19	PF13516 LRR_6	2.2e+02	13.3	Leucine Rich repeat
20	PF13855 LRR_8	1.9e-25	99.7	Leucine rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000298910

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000335153	0.999	Heat shock protein HSP 90-alpha
2	9606.ENSP00000353444	0.997	Ras-related protein Rab-5B
3	9606.ENSP00000449089	0.997	Dynamin-1-like protein
4	9606.ENSP00000356107	0.996	Ras-related protein Rab-7L1
5	9606.ENSP00000355865	0.994	E3 ubiquitin-protein ligase parkin
6	9606.ENSP00000265062	0.991	Ras-related protein Rab-7a
7	9606.ENSP00000338345	0.989	Alpha-synuclein
8	9606.ENSP00000340989	0.988	14-3-3 protein sigma
9	9606.ENSP00000368169	0.987	Segment polarity protein dishevelled homolog DVL-1
10	9606.ENSP00000364893	0.981	Rho guanine nucleotide exchange factor 7
11	9606.ENSP00000261349	0.979	Low-density lipoprotein receptor-related protein 6
12	9606.ENSP00000299138	0.979	Vacuolar protein sorting-associated protein 35
13	9606.ENSP00000383118	0.978	Cell division control protein 42 homolog
14	9606.ENSP00000356465	0.975	Ras-related protein Rab-32
15	9606.ENSP00000418770	0.973	Protein/nucleic acid deglycase DJ-1
16	9606.ENSP00000314499	0.972	Cyclin-G-associated kinase
17	9606.ENSP00000364204	0.971	Serine/threonine-protein kinase PINK1, mitochondrial
18	9606.ENSP00000222005	0.963	Hsp90 co-chaperone Cdc37
19	9606.ENSP00000273047	0.960	Ras-related protein Rab-5A
20	9606.ENSP00000353408	0.953	Moesin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0035639	0.997	purine ribonucleoside triphosphate binding
GO:0004674	0.997	protein serine/threonine kinase activity
GO:0032555	0.996	purine ribonucleotide binding
GO:0032561	0.992	guanyl ribonucleotide binding
GO:0019899	0.991	enzyme binding
GO:0051018	0.980	protein kinase A binding
GO:0042802	0.980	identical protein binding
GO:0030159	0.979	signaling receptor complex adaptor activity
GO:0005525	0.978	GTP binding
GO:0051020	0.977	GTPase binding
GO:0031267	0.973	small GTPase binding
GO:0016787	0.953	hydrolase activity
GO:0017111	0.926	ribonucleoside triphosphate phosphatase activity
GO:0098772	0.915	molecular function regulator activity
GO:0008092	0.914	cytoskeletal protein binding
GO:0003924	0.907	GTPase activity
GO:0140678	0.901	molecular function inhibitor activity
GO:0000287	0.896	magnesium ion binding
GO:0140677	0.893	molecular function activator activity
GO:0030234	0.888	enzyme regulator activity
GO:0000149	0.884	SNARE binding
GO:0060589	0.877	nucleoside-triphosphatase regulator activity
GO:0030695	0.873	GTPase regulator activity
GO:0017075	0.861	syntaxin-1 binding
GO:0015631	0.851	tubulin binding
GO:0044325	0.850	transmembrane transporter binding
GO:0030276	0.848	clathrin binding
GO:0008017	0.842	microtubule binding
GO:0004709	0.841	MAP kinase kinase kinase activity
GO:0008047	0.836	enzyme activator activity
GO:0003779	0.833	actin binding
GO:0004857	0.827	enzyme inhibitor activity
GO:0005096	0.820	GTPase activator activity
GO:0044877	0.647	protein-containing complex binding
GO:0046983	0.572	protein dimerization activity
GO:0042803	0.563	protein homodimerization activity
GO:0004706	0.540	JUN kinase kinase kinase activity
GO:0039706	0.538	co-receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0008152	0.995	metabolic process
GO:0071704	0.993	organic substance metabolic process
GO:0044238	0.992	primary metabolic process
GO:0050794	0.991	regulation of cellular process
GO:0044237	0.988	cellular metabolic process
GO:0006807	0.985	nitrogen compound metabolic process
GO:0048518	0.981	positive regulation of biological process
GO:0060255	0.979	regulation of macromolecule metabolic process
GO:0019538	0.979	protein metabolic process
GO:0050896	0.973	response to stimulus
GO:0048523	0.969	negative regulation of cellular process
GO:0071840	0.967	cellular component organization or biogenesis
GO:0010604	0.966	positive regulation of macromolecule metabolic process
GO:0051716	0.961	cellular response to stimulus
GO:0016043	0.959	cellular component organization
GO:0036211	0.955	protein modification process
GO:0048583	0.953	regulation of response to stimulus
GO:0032501	0.950	multicellular organismal process
GO:0006796	0.950	phosphate-containing compound metabolic process
GO:0016310	0.943	phosphorylation
GO:0048522	0.912	positive regulation of cellular process
GO:0051128	0.891	regulation of cellular component organization
GO:0006468	0.798	protein phosphorylation
GO:0051171	0.785	regulation of nitrogen compound metabolic process
GO:0010468	0.783	regulation of gene expression
GO:0080090	0.779	regulation of primary metabolic process
GO:0051246	0.744	regulation of protein metabolic process
GO:0046777	0.726	protein autophosphorylation
GO:0032879	0.708	regulation of localization
GO:0031323	0.680	regulation of cellular metabolic process
GO:0032502	0.678	developmental process
GO:0048856	0.638	anatomical structure development
GO:0051049	0.581	regulation of transport
GO:0042221	0.547	response to chemical
GO:0031399	0.544	regulation of protein modification process
GO:0065009	0.538	regulation of molecular function
GO:0007275	0.521	multicellular organism development
GO:0007154	0.511	cell communication
GO:0023052	0.486	signaling
GO:0051179	0.482	localization
GO:0051173	0.481	positive regulation of nitrogen compound metabolic process
GO:0006996	0.464	organelle organization
GO:0031325	0.460	positive regulation of cellular metabolic process
GO:0010646	0.449	regulation of cell communication
GO:0007165	0.448	signal transduction
GO:0051247	0.438	positive regulation of protein metabolic process
GO:0048731	0.425	system development
GO:0070887	0.411	cellular response to chemical stimulus
GO:0080134	0.395	regulation of response to stress
GO:0051239	0.384	regulation of multicellular organismal process
GO:0060627	0.367	regulation of vesicle-mediated transport
GO:0048513	0.359	animal organ development
GO:0010975	0.358	regulation of neuron projection development
GO:0051641	0.353	cellular localization
GO:0009894	0.349	regulation of catabolic process
GO:0023051	0.348	regulation of signaling
GO:0006810	0.339	transport
GO:0009966	0.337	regulation of signal transduction
GO:0071310	0.321	cellular response to organic substance
GO:0048584	0.318	positive regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.998	membrane
GO:0005737	0.998	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0045202	0.997	synapse
GO:0030424	0.997	axon
GO:0030425	0.997	dendrite
GO:0012505	0.995	endomembrane system
GO:0071944	0.985	cell periphery
GO:0005829	0.984	cytosol
GO:0005886	0.983	plasma membrane
GO:0032991	0.980	protein-containing complex
GO:0044297	0.976	cell body
GO:0043025	0.972	neuronal cell body
GO:0031090	0.950	organelle membrane
GO:0031982	0.925	vesicle
GO:0005739	0.877	mitochondrion
GO:0031410	0.786	cytoplasmic vesicle
GO:0005764	0.782	lysosome
GO:0070013	0.771	intracellular organelle lumen
GO:0005634	0.764	nucleus
GO:0005768	0.759	endosome
GO:0005794	0.758	Golgi apparatus
GO:0005740	0.747	mitochondrial envelope
GO:0098588	0.742	bounding membrane of organelle
GO:0005783	0.741	endoplasmic reticulum
GO:0031966	0.637	mitochondrial membrane
GO:0031981	0.503	nuclear lumen
GO:0005654	0.476	nucleoplasm
GO:0005741	0.470	mitochondrial outer membrane
GO:0045121	0.458	membrane raft
GO:0065010	0.436	extracellular membrane-bounded organelle
GO:0070062	0.406	extracellular exosome
GO:0043195	0.405	terminal bouton
GO:1990909	0.391	Wnt signalosome
GO:0070971	0.390	endoplasmic reticulum exit site
GO:0043204	0.320	perikaryon

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.997	Phosphotransferases with an alcohol group as acceptor.
EC:3.-.-.-	0.953	Hydrolases.
RHEA:23680	0.926	a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate
EC:3.6.1.15	0.926	nucleoside-triphosphate phosphatase.
RHEA:19669	0.907	GTP + H2O = GDP + H(+) + phosphate
EC:2.7.11.25	0.841	mitogen-activated protein kinase kinase kinase.

[back to server]