StarFunc result for job id Q5SGD2

User Input

>input (360 residues)
MIEDTMTLLSLLGRIMRYFLLRPETLFLLCISLALWSYFFHTDEVKTIVKSSRDAVKMVK
GKVAEIMQNDRLGGLDVLEAEFSKTWEFKNHNVAVYSIQGRRDHMEDRFEVLTDLANKTH
PSIFGIFDGHGGETAAEYVKSRLPEALKQHLQDYEKDKENSVLSYQTILEQQILSIDREM
LEKLTVSYDEAGTTCLIALLSDKDLTVANVGDSRGVLCDKDGNAIPLSHDHKPYQLKERK
RIKRAGGFISFNGSWRVQGILAMSRSLGDYPLKNLNVVIPDPDILTFDLDKLQPEFMILA
SDGLWDAFSNEEAVRFIKERLDEPHFGAKSIVLQSFYRGCPDNITVMVVKFRNSSKTEEQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5SGD2	1.000	1.000	3.514E-71	360	1.000	1.000	Q5SGD2.pdb.gz	PPM1L_HUMAN Protein phosphatase 1L OS=Homo sapiens OX=9606 GN=PPM1L PE=1 SV=1
2	AFDB:Q4PSE8	0.675	0.548	2.275E-29	447	0.319	0.257	Q4PSE8.pdb.gz	P2C71_ARATH Probable protein phosphatase 2C 71 OS=Arabidopsis thaliana OX=3702 GN=At5g24940 PE=2 SV=1
3	AFDB:Q8LAY8	0.660	0.671	5.722E-29	354	0.314	0.319	Q8LAY8.pdb.gz	P2C69_ARATH Probable protein phosphatase 2C 69 OS=Arabidopsis thaliana OX=3702 GN=At5g10740 PE=2 SV=1
4	AFDB:Q94AT1	0.665	0.573	8.087E-29	420	0.308	0.264	Q94AT1.pdb.gz	P2C76_ARATH Probable protein phosphatase 2C 76 OS=Arabidopsis thaliana OX=3702 GN=At5g53140 PE=2 SV=1
5	AFDB:Q8RXV3	0.679	0.782	1.439E-28	311	0.317	0.367	Q8RXV3.pdb.gz	P2C59_ARATH Probable protein phosphatase 2C 59 OS=Arabidopsis thaliana OX=3702 GN=WIN2 PE=1 SV=1
6	AFDB:Q6EN45	0.643	0.638	2.562E-28	363	0.286	0.284	Q6EN45.pdb.gz	P2C13_ORYSJ Probable protein phosphatase 2C member 13, mitochondrial OS=Oryza sativa subsp. japonica OX=39947 GN=PP2C13 PE=2 SV=1
7	AFDB:Q9XEE8	0.668	0.618	5.457E-26	390	0.256	0.236	Q9XEE8.pdb.gz	P2C30_ARATH Probable protein phosphatase 2C 30 OS=Arabidopsis thaliana OX=3702 GN=PP2C5 PE=2 SV=1
8	AFDB:Q8BXN7	0.648	0.627	6.872E-26	372	0.253	0.245	Q8BXN7.pdb.gz	PPM1K_MOUSE Protein phosphatase 1K, mitochondrial OS=Mus musculus OX=10090 GN=Ppm1k PE=1 SV=1
9	AFDB:Q65XK7	0.652	0.617	7.280E-26	381	0.244	0.231	Q65XK7.pdb.gz	P2C51_ORYSJ Protein phosphatase 2C 51 OS=Oryza sativa subsp. japonica OX=39947 GN=PP2C51 PE=1 SV=1
10	AFDB:F1R0V7	0.644	0.624	2.306E-25	372	0.239	0.231	F1R0V7.pdb.gz
11	PDB:4oicB	0.633	0.740	8.445E-24	305	0.258	0.305	4oicB.pdb.gz	Identification and characterization of ABA receptors in Oryza sativa
12	PDB:1a6qA	0.654	0.650	2.392E-22	363	0.233	0.231	1a6qA.pdb.gz	Crystal structure of the protein serine/threonine phosphatase 2C at 2.0 A resolution.
13	PDB:4jndA	0.638	0.566	1.134E-21	408	0.183	0.162	4jndA.pdb.gz	Structural insight into Caenorhabditis elegans sex-determining protein FEM-2.
14	PDB:7kprA	0.598	0.540	1.625E-17	403	0.219	0.196	7kprA.pdb.gz	Structural basis for the specificity of PPM1H phosphatase for Rab GTPases.
15	PDB:5nzzD	0.598	0.570	4.374E-14	379	0.197	0.187	5nzzD.pdb.gz	The TAB1-p38 alpha complex aggravates myocardial injury and can be targeted by small molecules.
16	PDB:5d2uA	0.514	0.744	7.348E-14	240	0.172	0.258	5d2uA.pdb.gz	Structural and Biochemical Characterization of a Cyanobacterial PP2C Phosphatase Reveals Insights into Catalytic Mechanism and Substrate Recognition
17	PDB:6jkvA	0.510	0.766	1.317E-11	230	0.153	0.239	6jkvA.pdb.gz	Crystal structure of PppA from Pseudomonas aeruginosa, a key regulatory component of type VI secretion systems.
18	PDB:2pk0A	0.511	0.723	4.171E-11	247	0.139	0.202	2pk0A.pdb.gz	Structure of Streptococcus agalactiae serine/threonine phosphatase. The subdomain conformation is coupled to the binding of a third metal ion
19	PDB:3w40A	0.385	0.625	3.742E-9	199	0.106	0.191	3w40A.pdb.gz	Structure of the RsbX phosphatase involved in the general stress response of Bacillus subtilis
20	PDB:6rreD	0.433	0.375	7.549E-6	427	0.103	0.087	6rreD.pdb.gz	Structural insight into the membrane targeting domain of the Legionella deAMPylase SidD.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5SGD2	0.0	746	360	1.000	1.000	PPM1L_HUMAN Protein phosphatase 1L OS=Homo sapiens OX=9606 GN=PPM1L PE=1 SV=1
2	Q8BHN0	0.0	741	360	0.992	0.992	PPM1L_MOUSE Protein phosphatase 1L OS=Mus musculus OX=10090 GN=Ppm1l PE=1 SV=1
3	Q8RXV3	6.53e-59	194	311	0.314	0.363	P2C59_ARATH Probable protein phosphatase 2C 59 OS=Arabidopsis thaliana OX=3702 GN=WIN2 PE=1 SV=1
4	Q4PSE8	1.12e-57	195	447	0.317	0.255	P2C71_ARATH Probable protein phosphatase 2C 71 OS=Arabidopsis thaliana OX=3702 GN=At5g24940 PE=2 SV=1
5	Q8LAY8	1.79e-57	192	354	0.317	0.322	P2C69_ARATH Probable protein phosphatase 2C 69 OS=Arabidopsis thaliana OX=3702 GN=At5g10740 PE=2 SV=1
6	Q94AT1	1.62e-52	181	420	0.303	0.260	P2C76_ARATH Probable protein phosphatase 2C 76 OS=Arabidopsis thaliana OX=3702 GN=At5g53140 PE=2 SV=1
7	Q6EN45	3.67e-49	171	363	0.303	0.300	P2C13_ORYSJ Probable protein phosphatase 2C member 13, mitochondrial OS=Oryza sativa subsp. japonica OX=39947 GN=PP2C13 PE=2 SV=1
8	O80871	8.83e-46	162	396	0.275	0.250	P2C25_ARATH Probable protein phosphatase 2C 25 OS=Arabidopsis thaliana OX=3702 GN=At2g30020 PE=1 SV=1
9	Q9XEE8	4.11e-42	153	390	0.269	0.249	P2C30_ARATH Probable protein phosphatase 2C 30 OS=Arabidopsis thaliana OX=3702 GN=PP2C5 PE=2 SV=1
10	Q3EAF9	9.33e-40	146	384	0.267	0.250	P2C49_ARATH Probable protein phosphatase 2C 49 OS=Arabidopsis thaliana OX=3702 GN=At3g62260 PE=2 SV=1
11	P49596	2.37e-39	145	356	0.269	0.272	PP2C2_CAEEL Probable protein phosphatase 2C T23F11.1 OS=Caenorhabditis elegans OX=6239 GN=ppm-2 PE=3 SV=2
12	Q09172	1.16e-37	140	370	0.275	0.268	PP2C2_SCHPO Protein phosphatase 2C homolog 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ptc2 PE=3 SV=1
13	Q586U3	3.75e-37	138	319	0.253	0.285	Q586U3_TRYB2 Protein phosphatase 2C, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30M24.55 PE=4 SV=1
14	Q9SLA1	9.25e-37	139	392	0.264	0.242	P2C22_ARATH Probable protein phosphatase 2C 22 OS=Arabidopsis thaliana OX=3702 GN=At2g25620 PE=1 SV=1
15	Q5U386	2.39e-36	137	382	0.258	0.243	Q5U386_DANRE Protein phosphatase 1A, magnesium dependent, alpha OS=Danio rerio OX=7955 GN=ppm1a PE=1 SV=1
16	P36993	2.40e-36	137	390	0.261	0.241	PPM1B_MOUSE Protein phosphatase 1B OS=Mus musculus OX=10090 GN=Ppm1b PE=1 SV=1
17	P49597	2.83e-36	138	434	0.308	0.256	P2C56_ARATH Protein phosphatase 2C 56 OS=Arabidopsis thaliana OX=3702 GN=ABI1 PE=1 SV=2
18	Q381U4	4.44e-36	137	429	0.269	0.226	Q381U4_TRYB2 Protein phosphatase 2C, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.6540 PE=4 SV=1
19	Q9ZW21	1.08e-35	135	362	0.264	0.262	P2C24_ARATH Probable protein phosphatase 2C 24 OS=Arabidopsis thaliana OX=3702 GN=At2g29380 PE=1 SV=1
20	Q9LNW3	3.96e-35	135	442	0.231	0.188	P2C03_ARATH Protein phosphatase 2C 3 OS=Arabidopsis thaliana OX=3702 GN=AIP1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00481 PP2C	1.3e-56	203.7	Protein phosphatase 2C
2	PF13672 PP2C_2	6.1e-05	34.3	Protein phosphatase 2C
3	PF07228 SpoIIE	4.6	18.6	Stage II sporulation protein E (SpoIIE)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 10029.XP_007634441.1

Rank	PPI partner	STRING score	Description
1	10029.XP_007625459.1	0.684	Oxysterol-binding protein 1
2	10029.NP_001230955.1	0.678	Shelters ceramides and diacylglycerol lipids inside its START domain and mediates the intracellular trafficking of ceramides and diacylglycerol lipids in a non-vesicular manner .
3	10029.XP_007612120.1	0.633	TGF-beta-activated kinase 1 and MAP3K7-binding protein 2 isoform X2
4	10029.XP_007637908.1	0.631	Dual specificity mitogen-activated protein kinase kinase 4 isoform X2
5	10029.XP_007617073.1	0.608	Dual specificity mitogen-activated protein kinase kinase 3
6	10029.XP_007620398.1	0.604	Belongs to the OSBP family.
7	10029.XP_007635470.1	0.600	Mitogen-activated protein kinase kinase kinase 7
8	10029.XP_007628860.1	0.594	Protein phosphatase 1 catalytic subunit gamma
9	10029.XP_007607091.1	0.591	Ecotropic virus integration site 1 protein
10	10029.XP_007632380.1	0.591	Endonuclease domain-containing 1 protein isoform X2
11	10029.XP_007608669.1	0.589	N-acetylated alpha-linked acidic dipeptidase like 2
12	10029.XP_007608678.1	0.589	Inactive N-acetylated-alpha-linked acidic dipeptidase-like protein 2
13	10029.XP_007614853.1	0.589	The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO(2). It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3)
14	10029.XP_007624213.1	0.589	Ankycorbin
15	10029.XP_007608154.1	0.580	Serine beta-lactamase-like protein LACTB, mitochondrial isoform X2
16	10029.XP_007620147.1	0.580	Serine/threonine protein kinase NLK
17	10029.XP_007607640.1	0.577	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: substituted 2 bases at 2 genomic stop codons
18	10029.XP_007610790.1	0.577	Exosome component 4
19	10029.XP_007619944.1	0.577	VAMP associated protein A
20	10029.XP_007630040.1	0.577	Dual specificity mitogen-activated protein kinase kinase 6 isoform X3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004722	1.000	protein serine/threonine phosphatase activity
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0071704	0.985	organic substance metabolic process
GO:0050789	0.985	regulation of biological process
GO:0044238	0.983	primary metabolic process
GO:0044237	0.983	cellular metabolic process
GO:0050794	0.981	regulation of cellular process
GO:0050896	0.975	response to stimulus
GO:0006807	0.970	nitrogen compound metabolic process
GO:0051716	0.922	cellular response to stimulus
GO:1901564	0.902	organonitrogen compound metabolic process
GO:0007154	0.847	cell communication
GO:0023052	0.842	signaling
GO:0007165	0.826	signal transduction
GO:0006643	0.623	membrane lipid metabolic process
GO:0009058	0.599	biosynthetic process
GO:1901576	0.586	organic substance biosynthetic process
GO:0044249	0.586	cellular biosynthetic process
GO:0035556	0.562	intracellular signal transduction
GO:0006665	0.457	sphingolipid metabolic process
GO:0043170	0.453	macromolecule metabolic process
GO:0000165	0.438	MAPK cascade
GO:0008610	0.415	lipid biosynthetic process
GO:0019538	0.379	protein metabolic process
GO:0030148	0.338	sphingolipid biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.978	endomembrane system
GO:0005576	0.968	extracellular region
GO:0031090	0.967	organelle membrane
GO:0031982	0.955	vesicle
GO:0031974	0.915	membrane-enclosed lumen
GO:0070013	0.825	intracellular organelle lumen
GO:0065010	0.801	extracellular membrane-bounded organelle
GO:1903561	0.788	extracellular vesicle
GO:0005783	0.771	endoplasmic reticulum
GO:0005615	0.694	extracellular space
GO:0042175	0.677	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0098827	0.674	endoplasmic reticulum subcompartment
GO:0005789	0.652	endoplasmic reticulum membrane
GO:0070062	0.556	extracellular exosome
GO:0005634	0.336	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.16	1.000	protein-serine/threonine phosphatase.

[back to server]