StarFunc result for job id Q5SNV9

User Input

>input (1468 residues)
MTRMSCPWGSYQWEPGACPAAPRGIGGGDMAGGIPDVRGLQEAALGAGRSQEEARLVEEA
QTPVMLPQDSGQRVEEVPGDLMAKRMSLILHVQKLPWDHVPCLRRTRQNLYQDVGGHAHG
SGLGGAKRGAARSALRRPLPPATCRPAGIVSGPSPRLDSNPTGAHLIKQTRPLTVEWTKD
TPVPEPMELRSDASHKENVSPKPAALPKPGKRLKQRRFRRSLGIGLSGRHDQWVPGCQVE
RGGPAATPSPGAVLDQEPCRVQTNLASPGPRLGLALKDTTGQLVNSSFWQQSNLQSLARR
RQGKAREFAIQQSNLSINETSSPHLCPEPGGSSGPHKLPWGPLLSQEPLARPSSCLRQSG
LPAPGTPSGDFRPTEAFAPLDGHTQPGLRSWGGLGSWRSRLVGEPLTLEDLAVPSQNQTQ
APSRAAVHQLLASVHCLAQEAARLRCQAPQEPPAWGVSPKQKGEEGAPRERVHREEERTA
FHLSDTVPASSASKNKAQNITAPESEAICWQLLSRCFRSWRHLVKRQREPAAAAVALGRW
QLLRKCLQALWLREAQLEAAWGQYTKVLLVRSFREVSGLQVGPGGRVKQCPGSLREEEIA
QRLLSHPRQRTDSRHERVQILQALQLAVFFLWCQQKKRARQERETLRKATRATQRTGSFP
QAWHSTAAGVAWVAPLSPQHQRAWLCRCFGAWQQFVQRGSRYRDHLADRRTGTLRKCLEQ
WVRMKQLRESDGAKVTQLSLCRQKAGREAVYTAGPGACGLGAVGQAQGQQEQGRGSLQDA
CWTLALCWALLLWKMRLFQRQWANSFFQGLQQRMLQRSLRWWHLRALGPDATSSCTKTPS
ALEPLSSSTLQDSLEKVPRAPTLPDTLQGSLLWAAGQRQQGQCLLLWQARAQQFQGTARW
YQHTRQRRIFLSWSRWATAQWAWRELASHRAWDRTCRAVLGLWRQRLLQSRLVEWWAQER
GWRLARDALCHWHSCWQGQQFLHEKCQTWVQVHLQGLQKVVFRSWQQAAAHQRCTVTRPE
QLLLQSYFQAWCEVVRDTGVLRAQHQAFQDGLRRRALGAVFATWREAQEVAAGAQEQRVA
QASLARWRSCGQQGQEDGQQKKARAPQAFPAWPVAPGMHHEAQQQAGESAGAQAAQCWTW
CWALWVHESCRGQVSRAHASWKPRAWVLEASVQSAVRGGVQRAILTQLRPAELRRFLRTV
QLRVRLGLPGAGKTRSCWTQATELVPPAPSLQCSLGGRRKPRGTAWAQRCREHSLCPAFQ
LWPQWPGQSSWVPGLPLWTRDQGPRAHSSPEPRACKAQSKAHKRRLRILEKQAQAHGSAL
LLALKGHDALGHQEEVPAAPVPRGTASRAAGFPAGQVPGSGMAALGGCPRGRAAGADPAQ
GVAPEMGLADVVAADPATASGSAVTAAGRWAFKKWHQRLAARSPRRGAASSPRPWSKPGP
KGPESGQEAARAPRGWGLGAEHGAQLQL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UPV0	0.050	0.051	5.249E-9	1460	0.159	0.160	Q9UPV0.pdb.gz	CE164_HUMAN Centrosomal protein of 164 kDa OS=Homo sapiens OX=9606 GN=CEP164 PE=1 SV=3
2	AFDB:Q5DU05	0.082	0.083	6.961E-9	1446	0.175	0.178	Q5DU05.pdb.gz	CE164_MOUSE Centrosomal protein of 164 kDa OS=Mus musculus OX=10090 GN=Cep164 PE=1 SV=2
3	AFDB:Q8N2N9	0.050	0.053	6.961E-9	1353	0.104	0.113	Q8N2N9.pdb.gz	AN36B_HUMAN Ankyrin repeat domain-containing protein 36B OS=Homo sapiens OX=9606 GN=ANKRD36B PE=1 SV=4
4	AFDB:Q8TES7	0.056	0.071	7.154E-8	1133	0.130	0.169	Q8TES7.pdb.gz	FBF1_HUMAN Fas-binding factor 1 OS=Homo sapiens OX=9606 GN=FBF1 PE=1 SV=2
5	AFDB:A0A024R370	0.043	0.057	1.791E-7	1093	0.113	0.152	A0A024R370.pdb.gz
6	AFDB:A2A870	0.049	0.057	4.179E-7	1173	0.140	0.176	A2A870.pdb.gz	FBF1_MOUSE Fas-binding factor 1 OS=Mus musculus OX=10090 GN=Fbf1 PE=1 SV=1
7	AFDB:B9EKI3	0.047	0.061	5.165E-7	1091	0.131	0.176	B9EKI3.pdb.gz	TMF1_MOUSE TATA element modulatory factor OS=Mus musculus OX=10090 GN=Tmf1 PE=1 SV=2
8	AFDB:Q96R06	0.084	0.101	7.890E-7	1193	0.095	0.117	Q96R06.pdb.gz	SPAG5_HUMAN Sperm-associated antigen 5 OS=Homo sapiens OX=9606 GN=SPAG5 PE=1 SV=2
9	AFDB:Q9VMA7	0.067	0.069	6.113E-6	1430	0.131	0.134	Q9VMA7.pdb.gz	TGO1_DROME Transport and Golgi organization protein 1 OS=Drosophila melanogaster OX=7227 GN=Tango1 PE=1 SV=2
10	AFDB:Q9SU08	0.047	0.075	8.108E-6	904	0.083	0.135	Q9SU08.pdb.gz	AUXI1_ARATH Auxilin-related protein 1 OS=Arabidopsis thaliana OX=3702 GN=AUXI1 PE=1 SV=2
11	PDB:7dvqR	0.030	0.117	1.052	241	0.020	0.124	7dvqR.pdb.gz	Structure of the activated human minor spliceosome.
12	PDB:4v60A	0.045	0.079	1.987	812	0.024	0.043	4v60A.pdb.gz
13	PDB:8at3A	0.033	0.138	4.319	286	0.024	0.122	8at3A.pdb.gz
14	PDB:7nac7	0.017	0.116	4.974	129	0.010	0.116	7nac7.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
15	PDB:7n85F	0.042	0.194	5.338	167	0.015	0.132	7n85F.pdb.gz
16	PDB:7r5jI0	0.030	0.173	5.729	173	0.024	0.202	7r5jI0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
17	PDB:5ijnH	0.046	0.248	6.148	169	0.016	0.136	5ijnH.pdb.gz
18	PDB:6zdbA	0.024	0.223	9.390	129	0.007	0.078	6zdbA.pdb.gz
19	PDB:6zr2h	0.027	0.203	9.390	138	0.014	0.152	6zr2h.pdb.gz	Structure of inhibitor-bound mammalian complex I.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9I7U4	0.70	37.0	18141	0.010	0.001	TITIN_DROME Titin OS=Drosophila melanogaster OX=7227 GN=sls PE=1 SV=3
2	P38295	4.8	33.9	451	0.016	0.051	MCFS2_YEAST Medium-chain fatty acid ethyl ester synthase/esterase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EHT1 PE=1 SV=1
3	O60079	7.0	33.5	979	0.015	0.022	UBP12_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp12 PE=1 SV=1
4	Q9VFK3	7.3	32.0	147	0.018	0.177	SOTI_DROME Male-specific protein scotti OS=Drosophila melanogaster OX=7227 GN=soti PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15736 DUF4684	5.7e-213	719.4	Domain of unknown function (DUF4684)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000414909

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000219301	0.821	Serine protease 54
2	9606.ENSP00000362784	0.813	Olfactory receptor 5C1
3	9606.ENSP00000321506	0.786	Olfactory receptor 4X1
4	9606.ENSP00000331385	0.681	Uncharacterized protein KIAA0825
5	9606.ENSP00000248072	0.657	Olfactory receptor 7C2
6	9606.ENSP00000302805	0.606	Protein DDI1 homolog 1
7	9606.ENSP00000258888	0.587	Alpha-protein kinase 3
8	9606.ENSP00000301917	0.556	Probable G-protein coupled receptor 25
9	9606.ENSP00000370521	0.526	Aryl-hydrocarbon-interacting protein-like 1
10	9606.ENSP00000477979	0.525	Neuroblastoma breakpoint family member 20
11	9606.ENSP00000346729	0.519	Zinc finger protein 589
12	9606.ENSP00000334042	0.502	Tachykinin-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0065007	0.945	biological regulation
GO:0050789	0.942	regulation of biological process
GO:0050794	0.841	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.995	membrane-bounded organelle
GO:0043229	0.995	intracellular organelle
GO:0005737	0.994	cytoplasm
GO:0043231	0.958	intracellular membrane-bounded organelle
GO:0005634	0.848	nucleus
GO:0043232	0.738	intracellular non-membrane-bounded organelle
GO:0005829	0.662	cytosol
GO:0016020	0.376	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]