StarFunc result for job id Q5SQQ9

User Input

>input (334 residues)
MFGKPDKMDVRCHSDAEAARVSKNAHKESRESKGAEGNLPAAFLKEPQGAFSASGAAEDC
NKSKSNSAADPDYCRRILVRDAKGSIREIILPKGLDLDRPKRTRTSFTAEQLYRLEMEFQ
RCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKKDQGKDSELRSVVSETAATCSVLR
LLEQGRLLSPPGLPALLPPCATGALGSALRGPSLPALGAGAAAGSAAAAAAAAPGPAGAA
SPHPPAVGGAPGPGPAGPGGLHAGAPAAGHSLFSLPVPSLLGSVASRLSSAPLTMAGSLA
GNLQELSARYLSSSAFEPYSRTNNKEGAEKKALD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q2NKI2	0.476	0.472	7.860E-45	338	0.967	0.956	Q2NKI2.pdb.gz	VAX1_MOUSE Ventral anterior homeobox 1 OS=Mus musculus OX=10090 GN=Vax1 PE=2 SV=2
2	AFDB:Q801E0	0.425	0.446	8.668E-35	317	0.683	0.719	Q801E0.pdb.gz	VAX1_DANRE Ventral anterior homeobox 1 OS=Danio rerio OX=7955 GN=vax1 PE=2 SV=1
3	AFDB:Q9PU20	0.377	0.413	7.797E-23	302	0.485	0.536	Q9PU20.pdb.gz	VAX2A_XENLA Ventral anterior homeobox 2a OS=Xenopus laevis OX=8355 GN=vax2-a PE=2 SV=1
4	AFDB:Q801E1	0.316	0.341	1.831E-22	307	0.449	0.489	Q801E1.pdb.gz	VAX2_DANRE Ventral anterior homeobox 2 OS=Danio rerio OX=7955 GN=vax2 PE=2 SV=1
5	AFDB:Q9WTP9	0.345	0.390	1.231E-21	292	0.449	0.514	Q9WTP9.pdb.gz	VAX2_MOUSE Ventral anterior homeobox 2 OS=Mus musculus OX=10090 GN=Vax2 PE=1 SV=1
6	AFDB:Q9UIW0	0.314	0.359	2.374E-21	290	0.422	0.486	Q9UIW0.pdb.gz	VAX2_HUMAN Ventral anterior homeobox 2 OS=Homo sapiens OX=9606 GN=VAX2 PE=1 SV=1
7	AFDB:P97474	0.184	0.194	7.439E-9	317	0.216	0.227	P97474.pdb.gz	PITX2_MOUSE Pituitary homeobox 2 OS=Mus musculus OX=10090 GN=Pitx2 PE=1 SV=2
8	AFDB:Q9W5Z2	0.182	0.193	8.483E-9	314	0.210	0.223	Q9W5Z2.pdb.gz	PITX2_DANRE Pituitary homeobox 2 OS=Danio rerio OX=7955 GN=pitx2 PE=2 SV=1
9	AFDB:Q9PWR3	0.182	0.186	2.592E-8	326	0.204	0.209	Q9PWR3.pdb.gz	PITX2_XENLA Pituitary homeobox 2 OS=Xenopus laevis OX=8355 GN=pitx2 PE=2 SV=1
10	AFDB:O42115	0.184	0.137	1.174E-7	453	0.266	0.196	O42115.pdb.gz	ARX_DANRE Aristaless-related homeobox protein OS=Danio rerio OX=7955 GN=arx PE=2 SV=1
11	PDB:4egcA	0.152	0.094	1.712E-2	539	0.048	0.030	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.157	0.619	1.401E-1	73	0.042	0.192	2hi3A.pdb.gz
13	PDB:8escP	0.098	0.115	2.531E-1	272	0.060	0.074	8escP.pdb.gz	Structure and flexibility of the yeast NuA4 histone acetyltransferase complex.
14	PDB:5ds9B	0.092	0.272	3.291E-1	98	0.024	0.082	5ds9B.pdb.gz	DNA Sequence Determinants Controlling Affinity, Stability and Shape of DNA Complexes Bound by the Nucleoid Protein Fis.
15	PDB:7fbyA	0.117	0.232	3.291E-1	153	0.033	0.072	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
16	PDB:6i9ra	0.070	0.207	4.571E-1	83	0.036	0.145	6i9ra.pdb.gz	Inhibition of mitochondrial translation suppresses glioblastoma stem cell growth.
17	PDB:7l08a	0.074	0.181	4.881E-1	108	0.042	0.130	7l08a.pdb.gz	Distinct mechanisms of the human mitoribosome recycling and antibiotic resistance.
18	PDB:7dcoL	0.129	0.101	8.256E-1	435	0.045	0.034	7dcoL.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
19	PDB:6v7wE	0.086	0.117	1.005	234	0.045	0.064	6v7wE.pdb.gz	A phage-encoded anti-activator inhibits quorum sensing in Pseudomonas aeruginosa.
20	PDB:5nr5A	0.117	0.314	1.396	113	0.027	0.080	5nr5A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q2NKI2	0.0	524	338	0.943	0.932	VAX1_MOUSE Ventral anterior homeobox 1 OS=Mus musculus OX=10090 GN=Vax1 PE=2 SV=2
2	Q5SQQ9	0.0	666	334	1.000	1.000	VAX1_HUMAN Ventral anterior homeobox 1 OS=Homo sapiens OX=9606 GN=VAX1 PE=1 SV=1
3	Q801E0	5.34e-153	434	317	0.683	0.719	VAX1_DANRE Ventral anterior homeobox 1 OS=Danio rerio OX=7955 GN=vax1 PE=2 SV=1
4	Q9PU20	4.50e-84	258	302	0.458	0.507	VAX2A_XENLA Ventral anterior homeobox 2a OS=Xenopus laevis OX=8355 GN=vax2-a PE=2 SV=1
5	Q801E1	3.22e-72	228	307	0.410	0.446	VAX2_DANRE Ventral anterior homeobox 2 OS=Danio rerio OX=7955 GN=vax2 PE=2 SV=1
6	Q9WTP9	8.48e-67	213	292	0.362	0.414	VAX2_MOUSE Ventral anterior homeobox 2 OS=Mus musculus OX=10090 GN=Vax2 PE=1 SV=1
7	Q9UIW0	9.04e-59	192	290	0.392	0.452	VAX2_HUMAN Ventral anterior homeobox 2 OS=Homo sapiens OX=9606 GN=VAX2 PE=1 SV=1
8	P18488	9.45e-20	92.0	497	0.123	0.082	EMS_DROME Homeotic protein empty spiracles OS=Drosophila melanogaster OX=7227 GN=ems PE=2 SV=2
9	Q568U8	2.61e-18	85.1	247	0.120	0.162	Q568U8_DANRE Empty spiracles homeobox 2 OS=Danio rerio OX=7955 GN=wu:fk69b03 PE=2 SV=1
10	Q91770	2.85e-18	84.7	233	0.117	0.167	NOT2_XENLA Homeobox protein not2 OS=Xenopus laevis OX=8355 GN=not2 PE=2 SV=1
11	G5EGF2	3.22e-18	80.9	106	0.105	0.330	G5EGF2_CAEEL COG-1B OS=Caenorhabditis elegans OX=6239 GN=cog-1 PE=2 SV=1
12	Q04743	4.44e-18	84.3	252	0.120	0.159	EMX2_HUMAN Homeobox protein EMX2 OS=Homo sapiens OX=9606 GN=EMX2 PE=1 SV=2
13	Q04744	4.52e-18	84.3	253	0.120	0.158	EMX2_MOUSE Homeobox protein EMX2 OS=Mus musculus OX=10090 GN=Emx2 PE=1 SV=3
14	Q04741	1.31e-17	84.0	290	0.123	0.141	EMX1_HUMAN Homeobox protein EMX1 OS=Homo sapiens OX=9606 GN=EMX1 PE=1 SV=3
15	Q8MZ02	1.45e-17	84.7	378	0.117	0.103	Q8MZ02_DROME Lateral muscles scarcer, isoform B OS=Drosophila melanogaster OX=7227 GN=lms PE=2 SV=1
16	Q04742	1.48e-17	83.2	257	0.123	0.160	EMX1_MOUSE Homeobox protein EMX1 OS=Mus musculus OX=10090 GN=Emx1 PE=1 SV=2
17	G5EGE2	1.56e-17	82.8	256	0.105	0.137	G5EGE2_CAEEL COG-1A OS=Caenorhabditis elegans OX=6239 GN=cog-1 PE=2 SV=1
18	Q06615	1.90e-17	82.4	236	0.114	0.161	NOTO_XENLA Homeobox protein notochord OS=Xenopus laevis OX=8355 GN=noto PE=2 SV=1
19	Q804S6	2.10e-17	82.0	231	0.114	0.165	EMX1_DANRE Homeobox protein EMX1 OS=Danio rerio OX=7955 GN=emx1 PE=2 SV=1
20	G5ECT8	6.59e-17	80.1	209	0.111	0.177	HM02_CAEEL Homeobox protein ceh-2 OS=Caenorhabditis elegans OX=6239 GN=ceh-2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	10	17.4	Homeobox KN domain
2	PF00046 Homeodomain	8.7e-19	78.4	Homeodomain
3	PF11569 Homez	4.6e+02	11.9	Homeodomain leucine-zipper encoding, Homez
4	PF13518 HTH_28	30	16.2	Helix-turn-helix domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000020086

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000021026	0.613	Zinc finger protein 462
2	61853.ENSNLEP00000001707	0.607	Uncharacterized protein
3	61853.ENSNLEP00000018697	0.558	CAP-GLY domain containing linker protein family, member 4
4	61853.ENSNLEP00000017976	0.551	Uncharacterized protein
5	61853.ENSNLEP00000006282	0.546	Glial fibrillary acidic protein
6	61853.ENSNLEP00000011027	0.540	Cadherin 19
7	61853.ENSNLEP00000008111	0.527	Stimulator of chondrogenesis 1
8	61853.ENSNLEP00000016689	0.526	SIX homeobox 6
9	61853.ENSNLEP00000002406	0.522	Interferon regulatory factor 6
10	61853.ENSNLEP00000003442	0.522	Plasmolipin
11	61853.ENSNLEP00000011936	0.521	Phosphatase and actin regulator 4
12	61853.ENSNLEP00000016490	0.520	Proteolipid protein 1
13	61853.ENSNLEP00000002513	0.516	Potassium channel tetramerization domain containing 4
14	61853.ENSNLEP00000022910	0.516	SIX homeobox 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990837	0.997	sequence-specific double-stranded DNA binding
GO:0003700	0.996	DNA-binding transcription factor activity
GO:0005515	0.980	protein binding
GO:0000981	0.976	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.950	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001227	0.826	DNA-binding transcription repressor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048856	0.995	anatomical structure development
GO:0032501	0.993	multicellular organismal process
GO:0065007	0.985	biological regulation
GO:0050794	0.980	regulation of cellular process
GO:0007275	0.980	multicellular organism development
GO:0048513	0.975	animal organ development
GO:0007399	0.963	nervous system development
GO:0009987	0.841	cellular process
GO:0019222	0.829	regulation of metabolic process
GO:0060255	0.818	regulation of macromolecule metabolic process
GO:0010468	0.776	regulation of gene expression
GO:0031323	0.766	regulation of cellular metabolic process
GO:0080090	0.759	regulation of primary metabolic process
GO:0051171	0.751	regulation of nitrogen compound metabolic process
GO:0009653	0.650	anatomical structure morphogenesis
GO:0048519	0.645	negative regulation of biological process
GO:0031326	0.628	regulation of cellular biosynthetic process
GO:0010556	0.625	regulation of macromolecule biosynthetic process
GO:0051252	0.597	regulation of RNA metabolic process
GO:0006355	0.586	regulation of DNA-templated transcription
GO:0030154	0.559	cell differentiation
GO:0048523	0.509	negative regulation of cellular process
GO:0006357	0.438	regulation of transcription by RNA polymerase II
GO:0048518	0.417	positive regulation of biological process
GO:0048522	0.399	positive regulation of cellular process
GO:0050896	0.390	response to stimulus
GO:0045892	0.323	negative regulation of DNA-templated transcription
GO:0010604	0.304	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.850	intracellular organelle lumen
GO:0031981	0.682	nuclear lumen
GO:0005654	0.500	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]