StarFunc result for job id Q5SRD1

User Input

>input (188 residues)
MEGGGGSGDKTTGVLAGFFGAGEAGYSHADLAGVPLTGMNPLCPYLNVDPRYLVQDTDEF
ILPTGANKTWGRFELAFFTIGGCCMTGAAFGAMNGLRLGLKETQNMAWSKPGNVQILNMV
TRQGALWANTLGSLALLYSAFGVIIEKTRGAEDDLNTVAAGTMTGMLYKCTVSEMALDSP
FCVLLSGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14925	0.351	0.327	4.465E-19	209	0.888	0.799	O14925.pdb.gz	TIM23_HUMAN Mitochondrial import inner membrane translocase subunit Tim23 OS=Homo sapiens OX=9606 GN=TIMM23 PE=1 SV=1
2	AFDB:Q7T2P6	0.352	0.329	3.726E-15	208	0.670	0.606	Q7T2P6.pdb.gz	TIM23_DANRE Mitochondrial import inner membrane translocase subunit Tim23 OS=Danio rerio OX=7955 GN=timm23 PE=2 SV=1
3	AFDB:P31368	0.228	0.091	9.498E-1	601	0.117	0.037	P31368.pdb.gz	PDM1_DROME Protein nubbin OS=Drosophila melanogaster OX=7227 GN=nub PE=2 SV=1
4	AFDB:O53654	0.208	0.255	1.227	136	0.117	0.162	O53654.pdb.gz	O53654_MYCTO Haemophore haem-binding domain-containing protein OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT0213 PE=1 SV=1
5	AFDB:Q9SHG7	0.150	0.176	1.227	154	0.138	0.169	Q9SHG7.pdb.gz	Q9SHG7_ARATH At1g17080/F6I1.24 OS=Arabidopsis thaliana OX=3702 GN=At1g17080 PE=1 SV=1
6	AFDB:Q9M7I9	0.161	0.185	1.585	146	0.096	0.123	Q9M7I9.pdb.gz	STEP1_ARATH Stress enhanced protein 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=SEP1 PE=2 SV=1
7	AFDB:Q96WS6	0.215	0.247	1.690	150	0.080	0.100	Q96WS6.pdb.gz	MEU15_SCHPO Meiotic expression up-regulated protein 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=meu15 PE=2 SV=1
8	AFDB:A1Z8R2	0.222	0.050	1.802	1199	0.090	0.014	A1Z8R2.pdb.gz	A1Z8R2_DROME ADD domain-containing protein 1, isoform A OS=Drosophila melanogaster OX=7227 GN=ADD1 PE=1 SV=1
9	AFDB:Q94AU9	0.221	0.235	1.802	174	0.112	0.121	Q94AU9.pdb.gz	RBCX1_ARATH Chaperonin-like RBCX protein 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RBCX1 PE=1 SV=1
10	AFDB:Q6S001	0.162	0.058	1.921	685	0.181	0.050	Q6S001.pdb.gz	KIF11_DICDI Kinesin-related protein 11 OS=Dictyostelium discoideum OX=44689 GN=kif11 PE=3 SV=1
11	PDB:3hybA	0.176	0.220	2.770	115	0.085	0.139	3hybA.pdb.gz
12	PDB:6z6oC	0.227	0.093	3.578	548	0.069	0.024	6z6oC.pdb.gz	Structural basis for the regulation of nucleosome recognition and HDAC activity by histone deacetylase assemblies.
13	PDB:3jb9A	0.209	0.034	3.815	1964	0.112	0.011	3jb9A.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
14	PDB:6peqF	0.154	0.204	4.623	134	0.080	0.112	6peqF.pdb.gz	Structures of the AMPA receptor in complex with its auxiliary subunit cornichon.
15	PDB:7egb1	0.170	0.094	4.929	405	0.101	0.047	7egb1.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
16	PDB:7cpuSN	0.233	0.280	5.602	150	0.138	0.173	7cpuSN.pdb.gz	A male germ-cell-specific ribosome controls male fertility.
17	PDB:2r6eA	0.180	0.098	5.972	387	0.085	0.041	2r6eA.pdb.gz
18	PDB:5sv0A	0.249	0.211	5.972	233	0.106	0.086	5sv0A.pdb.gz
19	PDB:7nyhK	0.251	0.451	5.972	100	0.032	0.060	7nyhK.pdb.gz
20	PDB:3tuiA	0.220	0.199	6.367	216	0.112	0.097	3tuiA.pdb.gz	Inward facing conformations of the MetNI methionine ABC transporter: Implications for the mechanism of transinhibition.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14925	4.22e-117	332	209	0.878	0.789	TIM23_HUMAN Mitochondrial import inner membrane translocase subunit Tim23 OS=Homo sapiens OX=9606 GN=TIMM23 PE=1 SV=1
2	Q9WTQ8	2.67e-104	300	209	0.846	0.761	TIM23_MOUSE Mitochondrial import inner membrane translocase subunit Tim23 OS=Mus musculus OX=10090 GN=Timm23 PE=1 SV=1
3	O35093	5.31e-103	296	209	0.840	0.756	TIM23_RAT Mitochondrial import inner membrane translocase subunit Tim23 OS=Rattus norvegicus OX=10116 GN=Timm23 PE=2 SV=1
4	Q7T2P6	1.18e-86	255	208	0.638	0.577	TIM23_DANRE Mitochondrial import inner membrane translocase subunit Tim23 OS=Danio rerio OX=7955 GN=timm23 PE=2 SV=1
5	Q9XVQ2	1.06e-13	68.9	242	0.218	0.169	Q9XVQ2_CAEEL Mitochondrial import inner membrane translocase subunit TIM23 OS=Caenorhabditis elegans OX=6239 GN=timm-23 PE=1 SV=1
6	Q9USM7	1.51e-10	60.1	210	0.213	0.190	TIM23_SCHPO Mitochondrial import inner membrane translocase subunit tim23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tim23 PE=3 SV=1
7	P32897	9.21e-10	58.2	222	0.234	0.198	TIM23_YEAST Mitochondrial import inner membrane translocase subunit TIM23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIM23 PE=1 SV=1
8	Q59YG5	1.11e-07	52.0	218	0.223	0.193	Q59YG5_CANAL Mitochondrial import inner membrane translocase subunit TIM23 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TIM23 PE=3 SV=1
9	Q9LNQ1	5.80e-04	41.2	187	0.191	0.193	TI231_ARATH Mitochondrial import inner membrane translocase subunit TIM23-1 OS=Arabidopsis thaliana OX=3702 GN=TIM23-1 PE=2 SV=1
10	Q38820	0.024	36.6	188	0.176	0.176	TI232_ARATH Mitochondrial import inner membrane translocase subunit TIM23-2 OS=Arabidopsis thaliana OX=3702 GN=TIM23-2 PE=1 SV=1
11	A2RVP7	0.18	33.9	173	0.080	0.087	TI221_ARATH Mitochondrial import inner membrane translocase subunit TIM22-1 OS=Arabidopsis thaliana OX=3702 GN=TIM22-1 PE=1 SV=1
12	A0A1D8PI78	0.31	33.1	184	0.096	0.098	TIM22_CANAL Mitochondrial import inner membrane translocase subunit TIM22 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TIM22 PE=1 SV=1
13	Q9Y584	0.36	33.1	194	0.128	0.124	TIM22_HUMAN Mitochondrial import inner membrane translocase subunit Tim22 OS=Homo sapiens OX=9606 GN=TIMM22 PE=1 SV=2
14	P87146	0.46	32.7	175	0.122	0.131	TIM22_SCHPO Mitochondrial import inner membrane translocase subunit tim22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tim22 PE=3 SV=1
15	S7VVK4	0.59	33.1	4367	0.074	0.003	GCY_TOXGG Guanylate cyclase OS=Toxoplasma gondii (strain ATCC 50853 / GT1) OX=507601 GN=GC PE=1 SV=1
16	Q9CQ85	2.6	30.4	194	0.117	0.113	TIM22_MOUSE Mitochondrial import inner membrane translocase subunit Tim22 OS=Mus musculus OX=10090 GN=Timm22 PE=1 SV=1
17	Q9W040	3.4	30.8	1754	0.090	0.010	OSM1_DROME Intraflagellar transport protein 172 homolog OS=Drosophila melanogaster OX=7227 GN=Oseg2 PE=3 SV=3
18	Q12328	4.6	30.0	207	0.085	0.077	TIM22_YEAST Mitochondrial import inner membrane translocase subunit TIM22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIM22 PE=1 SV=1
19	Q9NZK5	4.6	30.4	511	0.090	0.033	ADA2_HUMAN Adenosine deaminase 2 OS=Homo sapiens OX=9606 GN=ADA2 PE=1 SV=2
20	Q9V4C8	4.6	30.4	1500	0.074	0.009	HCF_DROME Host cell factor OS=Drosophila melanogaster OX=7227 GN=Hcf PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02466 Tim17	8.2e-15	66.6	Tim17/Tim22/Tim23/Pmp24 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363211

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356256	0.987	Mitochondrial import inner membrane translocase subunit Tim17-A
2	9606.ENSP00000379999	0.987	Translocase of inner mitochondrial membrane 17B
3	9606.ENSP00000216034	0.973	Mitochondrial import receptor subunit TOM22 homolog
4	9606.ENSP00000445806	0.967	Mitochondrial import inner membrane translocase subunit TIM50
5	9606.ENSP00000169551	0.956	Mitochondrial import inner membrane translocase subunit Tim21
6	9606.ENSP00000270538	0.954	Mitochondrial import inner membrane translocase subunit TIM44
7	9606.ENSP00000315693	0.952	Mitochondrial import inner membrane translocase subunit TIM16
8	9606.ENSP00000215570	0.947	Mitochondrial import inner membrane translocase subunit Tim13
9	9606.ENSP00000361993	0.946	Mitochondrial import inner membrane translocase subunit Tim8 A
10	9606.ENSP00000320236	0.918	Mitochondrial import inner membrane translocase subunit Tim22
11	9606.ENSP00000355566	0.913	Mitochondrial import receptor subunit TOM20 homolog
12	9606.ENSP00000372005	0.908	Mitochondrial import inner membrane translocase subunit TIM14
13	9606.ENSP00000368523	0.879	DnaJ homolog subfamily C member 15
14	9606.ENSP00000410339	0.876	Mitochondrial import receptor subunit TOM40 homolog
15	9606.ENSP00000257245	0.858	Mitochondrial import inner membrane translocase subunit Tim10
16	9606.ENSP00000363191	0.852	Reactive oxygen species modulator 1
17	9606.ENSP00000264954	0.814	GrpE protein homolog 1, mitochondrial
18	9606.ENSP00000284320	0.804	Mitochondrial import receptor subunit TOM70
19	9606.ENSP00000297185	0.800	Stress-70 protein, mitochondrial
20	9606.ENSP00000460885	0.773	Belongs to the WD repeat coronin family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0022857	0.862	transmembrane transporter activity
GO:0008320	0.637	protein transmembrane transporter activity
GO:0022804	0.364	active transmembrane transporter activity
GO:0015450	0.335	protein-transporting ATPase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0016043	0.991	cellular component organization
GO:0046907	0.989	intracellular transport
GO:0015031	0.976	protein transport
GO:0006886	0.937	intracellular protein transport
GO:0007005	0.928	mitochondrion organization
GO:0033365	0.887	protein localization to organelle
GO:0006839	0.858	mitochondrial transport
GO:0072594	0.853	establishment of protein localization to organelle
GO:0070585	0.835	protein localization to mitochondrion
GO:0006605	0.835	protein targeting
GO:0072655	0.832	establishment of protein localization to mitochondrion
GO:0006626	0.810	protein targeting to mitochondrion
GO:0065007	0.403	biological regulation
GO:0050789	0.362	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005743	0.995	mitochondrial inner membrane
GO:0032991	0.986	protein-containing complex
GO:0070013	0.958	intracellular organelle lumen
GO:0098798	0.834	mitochondrial protein-containing complex
GO:0098800	0.712	inner mitochondrial membrane protein complex
GO:0005744	0.702	TIM23 mitochondrial import inner membrane translocase complex
GO:0031970	0.613	organelle envelope lumen
GO:0005758	0.592	mitochondrial intermembrane space
GO:0031981	0.417	nuclear lumen
GO:0005654	0.385	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.-.-.-	0.335	Translocases.

[back to server]