StarFunc result for job id Q5SRE5

User Input

>input (1749 residues)
MAAAAGGPCVRSSRELWTILLGRSALRELSQIEAELNKHWRRLLEGLSYYKPPSPSSAEK
VKANKDVASPLKELGLRISKFLGLDEEQSVQLLQCYLQEDYRGTRDSVKTVLQDERQSQA
LILKIADYYYEERTCILRCVLHLLTYFQDERHPYRVEYADCVDKLEKELVSKYRQQFEEL
YKTEAPTWETHGNLMTERQVSRWFVQCLREQSMLLEIIFLYYAYFEMAPSDLLVLTKMFK
EQGFGSRQTNRHLVDETMDPFVDRIGYFSALILVEGMDIESLHKCALDDRRELHQFAQDG
LICQDMDCLMLTFGDIPHHAPVLLAWALLRHTLNPEETSSVVRKIGGTAIQLNVFQYLTR
LLQSLASGGNDCTTSTACMCVYGLLSFVLTSLELHTLGNQQDIIDTACEVLADPSLPELF
WGTEPTSGLGIILDSVCGMFPHLLSPLLQLLRALVSGKSTAKKVYSFLDKMSFYNELYKH
KPHDVISHEDGTLWRRQTPKLLYPLGGQTNLRIPQGTVGQVMLDDRAYLVRWEYSYSSWT
LFTCEIEMLLHVVSTADVIQHCQRVKPIIDLVHKVISTDLSIADCLLPITSRIYMLLQRL
TTVISPPVDVIASCVNCLTVLAARNPAKVWTDLRHTGFLPFVAHPVSSLSQMISAEGMNA
GGYGNLLMNSEQPQGEYGVTIAFLRLITTLVKGQLGSTQSQGLVPCVMFVLKEMLPSYHK
WRYNSHGVREQIGCLILELIHAILNLCHETDLHSSHTPSLQFLCICSLAYTEAGQTVINI
MGIGVDTIDMVMAAQPRSDGAEGQGQGQLLIKTVKLAFSVTNNVIRLKPPSNVVSPLEQA
LSQHGAHGNNLIAVLAKYIYHKHDPALPRLAIQLLKRLATVAPMSVYACLGNDAAAIRDA
FLTRLQSKIEDMRIKVMILEFLTVAVETQPGLIELFLNLEVKDGSDGSKEFSLGMWSCLH
AVLELIDSQQQDRYWCPPLLHRAAIAFLHALWQDRRDSAMLVLRTKPKFWENLTSPLFGT
LSPPSETSEPSILETCALIMKIICLEIYYVVKGSLDQSLKDTLKKFSIEKRFAYWSGYVK
SLAVHVAETEGSSCTSLLEYQMLVSAWRMLLIIATTHADIMHLTDSVVRRQLFLDVLDGT
KALLLVPASVNCLRLGSMKCTLLLILLRQWKRELGSVDEILGPLTEILEGVLQADQQLME
KTKAKVFSAFITVLQMKEMKVSDIPQYSQLVLNVCETLQEEVIALFDQTRHSLALGSATE
DKDSMETDDCSRSRHRDQRDGVCVLGLHLAKELCEVDEDGDSWLQVTRRLPILPTLLTTL
EVSLRMKQNLHFTEATLHLLLTLARTQQGATAVAGAGITQSICLPLLSVYQLSTNGTAQT
PSASRKSLDAPSWPGVYRLSMSLMEQLLKTLRYNFLPEALDFVGVHQERTLQCLNAVRTV
QSLACLEEADHTVGFILQLSNFMKEWHFHLPQLMRDIQVNLGYLCQACTSLLHSRKMLQH
YLQNKNGDGLPSAVAQRVQRPPSAASAAPSSSKQPAADTEASEQQALHTVQYGLLKILSK
TLAALRHFTPDVCQILLDQSLDLAEYNFLFALSFTTPTFDSEVAPSFGTLLATVNVALNM
LGELDKKKEPLTQAVGLSTQAEGTRTLKSLLMFTMENCFYLLISQAMRYLRDPAVHPRDK
QRMKQELSSELSTLLSSLSRYFRRGAPSSPATGVLPSPQGKSTSLSKASPESQEPLIQLV
QAFVRHMQR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7r5jB0	0.989	0.989	0.000	1748	0.999	0.999	7r5jB0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
2	AFDB:Q5SRE5	1.000	1.000	0.000	1749	1.000	1.000	Q5SRE5.pdb.gz	NU188_HUMAN Nucleoporin NUP188 OS=Homo sapiens OX=9606 GN=NUP188 PE=1 SV=1
3	PDB:5ijoJ	0.478	0.645	5.607E-76	1256	0.707	0.984	5ijoJ.pdb.gz
4	PDB:7r5jC0	0.541	0.484	1.644E-26	2011	0.184	0.160	7r5jC0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
5	AFDB:F4KBW6	0.500	0.482	4.143E-25	1838	0.167	0.159	F4KBW6.pdb.gz	NU205_ARATH Nuclear pore complex protein NUP205 OS=Arabidopsis thaliana OX=3702 GN=NUP205 PE=1 SV=1
6	AFDB:G0SFH5	0.641	0.607	1.317E-22	1858	0.136	0.128	G0SFH5.pdb.gz	NU188_CHATD Nucleoporin NUP188 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=NUP188 PE=1 SV=1
7	AFDB:Q8IQV9	0.558	0.483	3.442E-22	2090	0.160	0.134	Q8IQV9.pdb.gz	NU205_DROME Nuclear pore complex protein Nup205 OS=Drosophila melanogaster OX=7227 GN=Nup205 PE=2 SV=1
8	PDB:7wo9A	0.573	0.625	1.705E-19	1581	0.133	0.147	7wo9A.pdb.gz
9	PDB:7mvxA	0.606	0.640	3.503E-19	1645	0.134	0.143	7mvxA.pdb.gz
10	AFDB:Q21436	0.460	0.473	2.295E-16	1696	0.125	0.129	Q21436.pdb.gz	Q21436_CAEEL Nuclear Pore complex Protein OS=Caenorhabditis elegans OX=6239 GN=npp-3 PE=1 SV=1
11	PDB:7wooE	0.559	0.621	3.945E-15	1552	0.130	0.147	7wooE.pdb.gz
12	PDB:7mvvA	0.395	0.441	7.246E-13	1542	0.121	0.137	7mvvA.pdb.gz	Architecture of the linker-scaffold in the nuclear pore.
13	AFDB:Q583W5	0.411	0.362	3.175E-12	2070	0.129	0.109	Q583W5.pdb.gz	Q583W5_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.2H8.1110 PE=3 SV=1
14	PDB:5hb4B	0.350	0.417	8.522E-11	1388	0.115	0.145	5hb4B.pdb.gz
15	PDB:7n85O	0.398	0.439	1.007E-9	1521	0.124	0.143	7n85O.pdb.gz
16	PDB:7wooF	0.345	0.362	1.932E-9	1622	0.134	0.144	7wooF.pdb.gz
17	AFDB:A5HEI1	0.141	0.136	6.859E-8	1846	0.111	0.105	A5HEI1.pdb.gz	SCC2_ARATH Sister chromatid cohesion protein SCC2 OS=Arabidopsis thaliana OX=3702 GN=SCC2 PE=1 SV=1
18	AFDB:Q9VLT1	0.152	0.155	7.868E-8	1684	0.126	0.131	Q9VLT1.pdb.gz	MON2_DROME Protein MON2 homolog OS=Drosophila melanogaster OX=7227 GN=mon2 PE=2 SV=4
19	AFDB:Q581Z8	0.168	0.150	1.272E-7	2063	0.137	0.116	Q581Z8.pdb.gz	Q581Z8_TRYB2 SEC7 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26N11.250 PE=4 SV=1
20	AFDB:G5ED41	0.163	0.207	1.562E-7	1274	0.101	0.139	G5ED41.pdb.gz	CAND1_CAEEL Cullin-associated NEDD8-dissociated protein 1 OS=Caenorhabditis elegans OX=6239 GN=cand-1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5SRE5	0.0	3603	1749	1.000	1.000	NU188_HUMAN Nucleoporin NUP188 OS=Homo sapiens OX=9606 GN=NUP188 PE=1 SV=1
2	P52593	0.11	40.0	1655	0.065	0.069	NU188_YEAST Nucleoporin NUP188 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NUP188 PE=1 SV=1
3	B0BNF9	0.19	38.5	370	0.021	0.100	HAOX1_RAT 2-Hydroxyacid oxidase 1 OS=Rattus norvegicus OX=10116 GN=Hao1 PE=1 SV=1
4	Q9WU19	0.22	38.5	370	0.021	0.100	HAOX1_MOUSE 2-Hydroxyacid oxidase 1 OS=Mus musculus OX=10090 GN=Hao1 PE=1 SV=1
5	P47968	1.5	35.4	303	0.012	0.069	RPIA_MOUSE Ribose-5-phosphate isomerase OS=Mus musculus OX=10090 GN=Rpia PE=1 SV=2
6	P47054	3.9	34.7	1683	0.027	0.029	NU192_YEAST Nucleoporin NUP192 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NUP192 PE=1 SV=1
7	O75691	4.9	34.7	2785	0.014	0.009	UTP20_HUMAN Small subunit processome component 20 homolog OS=Homo sapiens OX=9606 GN=UTP20 PE=1 SV=3
8	Q21253	5.5	33.9	475	0.008	0.029	GELS1_CAEEL Gelsolin-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=gsnl-1 PE=1 SV=1
9	Q9P7M8	5.8	34.3	1564	0.032	0.036	NU184_SCHPO Nucleoporin nup184 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nup184 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04410 Gar1	1.7e+02	13.5	Gar1/Naf1 RNA binding region
2	PF10487 Nup188	1.3e-203	690.3	Nucleoporin subcomplex protein binding to Pom34

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361658

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000310668	0.999	Nuclear pore complex protein Nup93
2	9606.ENSP00000231498	0.998	Nuclear pore complex protein Nup155
3	9606.ENSP00000285968	0.997	Nuclear pore complex protein Nup205
4	9606.ENSP00000295119	0.985	Nucleoporin NUP53
5	9606.ENSP00000371155	0.985	Nucleoporin p58/p45
6	9606.ENSP00000471191	0.984	Nuclear pore glycoprotein p62
7	9606.ENSP00000264883	0.964	Nucleoporin p54
8	9606.ENSP00000444029	0.962	Nuclear pore complex protein Nup153
9	9606.ENSP00000229179	0.958	Nuclear pore complex protein Nup107
10	9606.ENSP00000382779	0.956	Nucleoporin SEH1
11	9606.ENSP00000308622	0.950	Nucleoporin GLE1
12	9606.ENSP00000245544	0.948	Nuclear pore complex protein Nup85
13	9606.ENSP00000342262	0.944	Nucleoporin Nup43
14	9606.ENSP00000352400	0.939	Nuclear pore complex protein Nup214
15	9606.ENSP00000458954	0.936	Nuclear pore complex protein Nup88
16	9606.ENSP00000254508	0.934	Nuclear pore membrane glycoprotein 210
17	9606.ENSP00000283195	0.929	E3 SUMO-protein ligase RanBP2
18	9606.ENSP00000484669	0.926	Cleavage and polyadenylation specificity factor subunit 1
19	9606.ENSP00000296464	0.923	Heat shock 70 kDa protein 4L
20	9606.ENSP00000238616	0.922	Serine/threonine-protein kinase Nek9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0051649	0.836	establishment of localization in cell
GO:0033036	0.832	macromolecule localization
GO:0006810	0.823	transport
GO:0034504	0.816	protein localization to nucleus
GO:0006606	0.796	protein import into nucleus
GO:0065007	0.435	biological regulation
GO:0050789	0.432	regulation of biological process
GO:0050794	0.410	regulation of cellular process
GO:0071840	0.390	cellular component organization or biogenesis
GO:0016043	0.370	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005829	1.000	cytosol
GO:0005635	1.000	nuclear envelope
GO:0032991	0.966	protein-containing complex
GO:0031981	0.956	nuclear lumen
GO:0140513	0.815	nuclear protein-containing complex
GO:0005654	0.598	nucleoplasm
GO:0005643	0.484	nuclear pore
GO:0031090	0.378	organelle membrane
GO:0031965	0.333	nuclear membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]