StarFunc result for job id Q5SSJ5

User Input

>input (553 residues)
MATDTSQGELVHPKALPLIVGAQLIHADKLGEKVEDSTMPIRRTVNSTRETPPKSKLAEG
EEEKPEPDISSEESVSTVEEQENETPPATSSEAEQPKGEPENEEKEENKSSEETKKDEKD
QSKEKEKKVKKTIPSWATLSASQLARAQKQTPMASSPRPKMDAILTEAIKACFQKSGASV
VAIRKYIIHKYPSLELERRGYLLKQALKRELNRGVIKQVKGKGASGSFVVVQKSRKTPQK
SRNRKNRSSAVDPEPQVKLEDVLPLAFTRLCEPKEASYSLIRKYVSQYYPKLRVDIRPQL
LKNALQRAVERGQLEQITGKGASGTFQLKKSGEKPLLGGSLMEYAILSAIAAMNEPKTCS
TTALKKYVLENHPGTNSNYQMHLLKKTLQKCEKNGWMEQISGKGFSGTFQLCFPYYPSPG
VLFPKKEPDDSRDEDEDEDESSEEDSEDEEPPPKRRLQKKTPAKSPGKAASVKQRGSKPA
PKVSAAQRGKARPLPKKAPPKAKTPAKKTRPSSTVIKKPSGGSSKKPATSARKEVKLPGK
GKSTMKKSFRVKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5SSJ5	1.000	1.000	2.456E-79	553	1.000	1.000	Q5SSJ5.pdb.gz	HP1B3_HUMAN Heterochromatin protein 1-binding protein 3 OS=Homo sapiens OX=9606 GN=HP1BP3 PE=1 SV=1
2	PDB:7k5yU	0.130	0.906	1.941E-3	75	0.043	0.320	7k5yU.pdb.gz	Distinct Structures and Dynamics of Chromatosomes with Different Human Linker Histone Isoforms.
3	PDB:7kbfK	0.132	0.859	4.311E-3	78	0.040	0.282	7kbfK.pdb.gz	Structural features of nucleosomes in interphase and metaphase chromosomes.
4	AFDB:D4ADV8	0.106	0.085	8.882E-3	716	0.121	0.094	D4ADV8.pdb.gz	D4ADV8_RAT Dishevelled segment polarity protein 3 OS=Rattus norvegicus OX=10116 GN=Dvl3 PE=1 SV=3
5	AFDB:A0A024R3M5	0.077	0.091	2.776E-2	452	0.110	0.135	A0A024R3M5.pdb.gz
6	PDB:7pe9I	0.099	0.163	2.825E-2	317	0.031	0.054	7pe9I.pdb.gz	Regulation of human mTOR complexes by DEPTOR.
7	AFDB:Q9LUR0	0.087	0.073	8.675E-2	683	0.121	0.098	Q9LUR0.pdb.gz	CNDH2_ARATH Condensin-2 complex subunit H2 OS=Arabidopsis thaliana OX=3702 GN=CAPH2 PE=2 SV=1
8	AFDB:E9PT37	0.076	0.040	1.153E-1	1207	0.148	0.068	E9PT37.pdb.gz	RBM20_RAT RNA-binding protein 20 OS=Rattus norvegicus OX=10116 GN=Rbm20 PE=1 SV=1
9	PDB:3euhC	0.083	0.184	1.243E-1	206	0.040	0.107	3euhC.pdb.gz
10	PDB:6labV	0.124	0.524	1.243E-1	109	0.060	0.303	6labV.pdb.gz	Engineering nucleosomes for generating diverse chromatin assemblies.
11	AFDB:Q09868	0.079	0.077	1.368E-1	576	0.148	0.142	Q09868.pdb.gz	CIP2_SCHPO RNA-binding post-transcriptional regulator cip2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cip2 PE=1 SV=1
12	AFDB:Q96JG8	0.103	0.081	1.623E-1	741	0.118	0.088	Q96JG8.pdb.gz	MAGD4_HUMAN Melanoma-associated antigen D4 OS=Homo sapiens OX=9606 GN=MAGED4 PE=1 SV=3
13	PDB:1w7pD	0.093	0.222	1.653E-1	171	0.043	0.140	1w7pD.pdb.gz
14	PDB:3cuqA	0.127	0.270	2.076E-1	219	0.038	0.096	3cuqA.pdb.gz
15	PDB:3m8eA	0.075	0.311	2.462E-1	101	0.027	0.149	3m8eA.pdb.gz
16	PDB:5oqj2	0.127	0.166	3.466E-1	395	0.060	0.084	5oqj2.pdb.gz	Structures of transcription pre-initiation complex with TFIIH and Mediator.
17	AFDB:A0A0B4JDA0	0.063	0.039	3.605E-1	1145	0.154	0.074	A0A0B4JDA0.pdb.gz	A0A0B4JDA0_DROME Moira, isoform B OS=Drosophila melanogaster OX=7227 GN=mor PE=1 SV=1
18	AFDB:A0A2R8YCW8	0.076	0.070	3.605E-1	748	0.150	0.111	A0A2R8YCW8.pdb.gz	A0A2R8YCW8_HUMAN Erythrocyte membrane protein band 4.1 OS=Homo sapiens OX=9606 GN=EPB41 PE=1 SV=1
19	PDB:2fe3B	0.089	0.298	3.884E-1	143	0.024	0.091	2fe3B.pdb.gz	Crystal structure of the apo-PerR-Zn protein from Bacillus subtilis.
20	AFDB:P22121	0.083	0.072	4.793E-1	677	0.101	0.083	P22121.pdb.gz	HSF_KLULA Heat shock transcription factor OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=HSF PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5SSJ5	0.0	1110	553	1.000	1.000	HP1B3_HUMAN Heterochromatin protein 1-binding protein 3 OS=Homo sapiens OX=9606 GN=HP1BP3 PE=1 SV=1
2	B0QZK4	7.62e-179	505	253	0.458	1.000	B0QZK4_HUMAN Heterochromatin protein 1 binding protein 3 (Fragment) OS=Homo sapiens OX=9606 GN=HP1BP3 PE=1 SV=1
3	Q8IZA3	3.47e-12	70.1	346	0.061	0.098	H18_HUMAN Histone H1.8 OS=Homo sapiens OX=9606 GN=H1-8 PE=2 SV=1
4	Q8VIK3	1.35e-11	67.8	304	0.067	0.122	H18_MOUSE Histone H1.8 OS=Mus musculus OX=10090 GN=H1.8 PE=2 SV=1
5	Q3HNG7	2.53e-10	64.3	343	0.078	0.125	H18_BOVIN Histone H1.8 OS=Bos taurus OX=9913 GN=H1-8 PE=1 SV=1
6	Q149N8	4.02e-05	49.3	1683	0.052	0.017	SHPRH_HUMAN E3 ubiquitin-protein ligase SHPRH OS=Homo sapiens OX=9606 GN=SHPRH PE=1 SV=2
7	P07305	6.79e-05	46.2	194	0.052	0.149	H10_HUMAN Histone H1.0 OS=Homo sapiens OX=9606 GN=H1-0 PE=1 SV=3
8	P10922	6.92e-05	46.2	194	0.052	0.149	H10_MOUSE Histone H1.0 OS=Mus musculus OX=10090 GN=H1-0 PE=2 SV=4
9	Q4V956	1.06e-04	46.6	257	0.038	0.082	Q4V956_DANRE Linker histone H1M OS=Danio rerio OX=7955 GN=fi06c02 PE=1 SV=1
10	P02255	1.15e-04	46.2	256	0.060	0.129	H1_DROME Histone H1 OS=Drosophila melanogaster OX=7227 GN=His1 PE=1 SV=1
11	P02259	3.22e-04	44.3	190	0.060	0.174	H5_CHICK Histone H5 OS=Gallus gallus OX=9031 PE=1 SV=2
12	Q18336	8.82e-04	43.5	232	0.054	0.129	H1X_CAEEL Histone H1.X OS=Caenorhabditis elegans OX=6239 GN=hil-1 PE=2 SV=1
13	P15308	0.003	42.4	273	0.038	0.077	B4_XENLA Protein B4 OS=Xenopus laevis OX=8355 GN=b4 PE=1 SV=1
14	P43276	0.007	40.4	223	0.040	0.099	H15_MOUSE Histone H1.5 OS=Mus musculus OX=10090 GN=H1-5 PE=1 SV=2
15	Q07133	0.007	40.4	208	0.034	0.091	H1T_MOUSE Histone H1t OS=Mus musculus OX=10090 GN=H1-6 PE=1 SV=4
16	P06349	0.008	40.4	208	0.034	0.091	H1T_RAT Histone H1t OS=Rattus norvegicus OX=10116 GN=H1-6 PE=1 SV=2
17	P22492	0.029	38.5	207	0.042	0.111	H1T_HUMAN Histone H1t OS=Homo sapiens OX=9606 GN=H1-6 PE=2 SV=4
18	P06350	0.030	38.5	207	0.040	0.106	H1_ONCMY Histone H1 OS=Oncorhynchus mykiss OX=8022 PE=1 SV=2
19	A5PK20	0.062	37.7	210	0.047	0.124	A5PK20_BOVIN H1.12 linker histone, cluster member OS=Bos taurus OX=9913 GN=H1-12 PE=2 SV=1
20	P17181	0.092	38.1	557	0.060	0.059	INAR1_HUMAN Interferon alpha/beta receptor 1 OS=Homo sapiens OX=9606 GN=IFNAR1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05432 BSP_II	11	17.3	Bone sialoprotein II (BSP-II)
2	PF00538 Linker_histone	3.5e-49	176.3	linker histone H1 and H5 family
3	PF05285 SDA1	29	15.6	SDA1
4	PF05764 YL1	30	16.2	YL1 nuclear protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000312625

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000311760	0.801	Belongs to the TTC9 family
2	9606.ENSP00000312811	0.676	Potassium channel subfamily K member 10
3	9606.ENSP00000273550	0.649	Ferritin heavy chain
4	9606.ENSP00000347626	0.648	NudC domain containing 3
5	9606.ENSP00000360231	0.616	Nuclear factor 1 A-type
6	9606.ENSP00000290541	0.592	Proteasome subunit beta type-4
7	9606.ENSP00000420658	0.592	Primate-specific protein involved in cortical expansion and folding in the developing neocortex. May drive neural progenitor proliferation through nuclear translocation of IQGAP1, which in turn promotes G1/S cell cycle transitions
8	9606.ENSP00000357122	0.557	Pyrin and HIN domain-containing protein 1
9	9606.ENSP00000434142	0.552	Tumor protein D52 like 1
10	9606.ENSP00000444136	0.528	DNA-directed RNA polymerase I subunit RPA2
11	9606.ENSP00000357113	0.506	Gamma-interferon-inducible protein 16
12	9606.ENSP00000419088	0.504	Protein FAM162A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	1.000	DNA binding
GO:0031491	0.999	nucleosome binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0009987	0.992	cellular process
GO:0019222	0.989	regulation of metabolic process
GO:0050794	0.985	regulation of cellular process
GO:0050896	0.978	response to stimulus
GO:0006355	0.975	regulation of DNA-templated transcription
GO:0016043	0.962	cellular component organization
GO:0051716	0.960	cellular response to stimulus
GO:0006325	0.942	chromatin organization
GO:0071453	0.940	cellular response to oxygen levels
GO:0065008	0.874	regulation of biological quality
GO:0036294	0.873	cellular response to decreased oxygen levels
GO:0006950	0.869	response to stress
GO:0071456	0.837	cellular response to hypoxia
GO:0090066	0.820	regulation of anatomical structure size
GO:0006338	0.624	chromatin remodeling
GO:0070828	0.375	heterochromatin organization
GO:0032535	0.343	regulation of cellular component size
GO:0048519	0.329	negative regulation of biological process
GO:0042127	0.314	regulation of cell population proliferation
GO:0048518	0.302	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016607	0.996	nuclear speck
GO:0005694	0.995	chromosome
GO:0005737	0.359	cytoplasm
GO:0032991	0.308	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]