StarFunc result for job id Q5ST30

User Input

>input (1063 residues)
MPHLPLASFRPPFWGLRHSRGLPRFHSVSTQSEPHGSPISRRNREAKQKRLREKQATLEA
EIAGESKSPAESIKAWRPKELVLYEIPTKPGEKKDVSGPLPPAYSPRYVEAAWYPWWVRE
GFFKPEYQARLPQATGETFSMCIPPPNVTGSLHIGHALTVAIQDALVRWHRMRGDQVLWV
PGSDHAGIATQAVVEKQLWKERGVRRHELSREAFLREVWQWKEAKGGEICEQLRALGASL
DWDRECFTMDVGSSVAVTEAFVRLYKAGLLYRNHQLVNWSCALRSAISDIEVENRPLPGH
TQLRLPGCPTPVSFGLLFSVAFPVDGEPDAEVVVGTTRPETLPGDVAVAVHPDDSRYTHL
HGRQLRHPLMGQPLPLITDYAVQPHVGTGAVKVTPAHSPADAEMGARHGLSPLNVIAEDG
TMTSLCGDWLQGLHRFVAREKIMSVLSEWGLFRGLQNHPMVLPICSRSGDVIEYLLKNQW
FVRCQEMGARAAKAVESGALELSPSFHQKNWQHWFSHIGDWCVSRQLWWGHQIPAYLVVE
DHAQGEEDCWVVGRSEAEAREVAAELTGRPGAELTLERDPDVLDTWFSSALFPFSALGWP
QETPDLARFYPLSLLETGSDLLLFWVGRMVMLGTQLTGQLPFSKVLLHPMVRDRQGRKMS
KSLGNVLDPRDIISGVEMQVLQEKLRSGNLDPAELAIVAAAQKKDFPHGIPECGTDALRF
TLCSHGVQAGDLHLSVSEVQSCRHFCNKIWNALRFILNALGEKFVPQPAEELSPSSPMDA
WILSRLALAAQECERGFLTRELSLVTHALHHFWLHNLCDVYLEAVKPVLWHSPRPLGPPQ
VLFSCADLGLRLLAPLMPFLAEELWQRLPPRPGCPPAPSISVAPYPSACSLEHWRQPELE
RRFSRVQEVVQVLRALRATYQLTKARPRVLLQSSEPGDQGLFEAFLEPLGTLGYCGAVGL
LPPGAAAPSGWAQAPLSDTAQVYMELQGLVDPQIQLPLLAARRYKLQKQLDSLTARTPSE
GEAGTQRQQKLSSLQLELSKLDKAASHLRQLMDEPPAPGSPEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RCN6	0.868	0.733	0.000	1264	0.488	0.411	A0A024RCN6.pdb.gz	A0A024RCN6_HUMAN Valine--tRNA ligase OS=Homo sapiens OX=9606 PE=1 SV=1
2	AFDB:A0A0B4KF06	0.877	0.883	0.000	1055	0.457	0.461	A0A0B4KF06.pdb.gz	A0A0B4KF06_DROME Valine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=ValRS PE=1 SV=1
3	AFDB:Q3U2A8	0.963	0.965	0.000	1060	0.834	0.837	Q3U2A8.pdb.gz	SYVM_MOUSE Valine--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Vars2 PE=1 SV=2
4	AFDB:Q5ST30	1.000	1.000	0.000	1063	1.000	1.000	Q5ST30.pdb.gz	SYVM_HUMAN Valine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=VARS2 PE=1 SV=2
5	AFDB:Q9U1Q4	0.877	0.888	6.924E-101	1050	0.428	0.433	Q9U1Q4.pdb.gz	SYV_CAEEL Valine--tRNA ligase OS=Caenorhabditis elegans OX=6239 GN=glp-4 PE=1 SV=1
6	AFDB:Q86KU2	0.849	0.842	7.748E-100	1072	0.415	0.411	Q86KU2.pdb.gz	SYVC_DICDI Probable valine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum OX=44689 GN=valS1 PE=3 SV=1
7	AFDB:P93736	0.822	0.790	1.466E-99	1108	0.426	0.409	P93736.pdb.gz	SYVM1_ARATH Valine--tRNA ligase, mitochondrial 1 OS=Arabidopsis thaliana OX=3702 GN=TWN2 PE=1 SV=2
8	AFDB:Q587B4	0.860	0.936	1.302E-96	975	0.412	0.449	Q587B4.pdb.gz	Q587B4_TRYB2 valine--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.26G9.740 PE=3 SV=1
9	AFDB:P07806	0.837	0.807	7.180E-95	1104	0.401	0.386	P07806.pdb.gz	SYV_YEAST Valine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAS1 PE=1 SV=2
10	AFDB:Q6FTE7	0.861	0.829	1.488E-94	1105	0.388	0.373	Q6FTE7.pdb.gz	Q6FTE7_CANGA valine--tRNA ligase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0G03091g PE=3 SV=1
11	PDB:7d5cA	0.640	0.733	4.038E-43	919	0.189	0.219	7d5cA.pdb.gz	Inhibitory mechanism of reveromycin A at the tRNA binding site of a class I synthetase.
12	PDB:3zgzD	0.403	0.487	9.592E-28	867	0.149	0.182	3zgzD.pdb.gz	Plant Tumour Biocontrol Agent Employs a tRNA-Dependent Mechanism to Inhibit Leucyl-tRNA Synthetase
13	PDB:4ariA	0.388	0.492	2.081E-27	821	0.155	0.201	4ariA.pdb.gz	Structural Dynamics of the Aminoacylation and Proofreading Functional Cycle of Bacterial Leucyl-tRNA Synthetase
14	PDB:6lpfB	0.455	0.479	1.617E-26	1006	0.145	0.153	6lpfB.pdb.gz	Molecular basis of the multifaceted functions of human leucyl-tRNA synthetase in protein synthesis and beyond.
15	PDB:6ax8A	0.392	0.777	9.415E-16	509	0.097	0.202	6ax8A.pdb.gz	The crystal structure of the drug target Mycobacterium tuberculosis methionyl-tRNA synthetase in complex with a catalytic intermediate.
16	PDB:5yymA	0.235	0.393	6.597E-7	581	0.070	0.127	5yymA.pdb.gz	Crystal Structures Of E.Coli Arginyl-Trna Synthetase (Argrs) In Complex With Substrates
17	PDB:1u0bB	0.244	0.512	8.857E-6	461	0.080	0.184	1u0bB.pdb.gz	Shape-selective RNA recognition by cysteinyl-tRNA synthetase
18	PDB:2ja2A	0.161	0.323	1.303E-4	485	0.090	0.198	2ja2A.pdb.gz
19	PDB:1f7uA	0.240	0.394	2.958E-4	606	0.065	0.114	1f7uA.pdb.gz	tRNA aminoacylation by arginyl-tRNA synthetase: induced conformations during substrates binding
20	PDB:5b63C	0.253	0.436	3.241E-4	553	0.067	0.128	5b63C.pdb.gz	Crystal structures of E.coli arginyl-tRNA synthetase (ArgRS) in complex with substrate tRNA(Arg)

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A024RCN6	991	1264	0.482	0.405	A0A024RCN6_HUMAN Valine--tRNA ligase OS=Homo sapiens OX=9606 PE=1 SV=1
2	A0A0B4KF06	935	1055	0.451	0.454	A0A0B4KF06_DROME Valine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=ValRS PE=1 SV=1
3	F4KE63	592	974	0.337	0.368	SYVM2_ARATH Valine--tRNA ligase, chloroplastic/mitochondrial 2 OS=Arabidopsis thaliana OX=3702 GN=EMB2247 PE=3 SV=1
4	O75005	805	980	0.384	0.416	SYV_SCHPO Valine--tRNA ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vas2 PE=3 SV=1
5	P07118	589	951	0.324	0.362	SYV_ECOLI Valine--tRNA ligase OS=Escherichia coli (strain K12) OX=83333 GN=valS PE=1 SV=2
6	P07806	792	1104	0.386	0.371	SYV_YEAST Valine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAS1 PE=1 SV=2
7	P26640	991	1264	0.482	0.405	SYVC_HUMAN Valine--tRNA ligase OS=Homo sapiens OX=9606 GN=VARS1 PE=1 SV=4
8	P93736	849	1108	0.421	0.403	SYVM1_ARATH Valine--tRNA ligase, mitochondrial 1 OS=Arabidopsis thaliana OX=3702 GN=TWN2 PE=1 SV=2
9	Q04462	988	1264	0.482	0.405	SYVC_RAT Valine--tRNA ligase OS=Rattus norvegicus OX=10116 GN=Vars1 PE=2 SV=2
10	Q0E993	939	1049	0.451	0.457	Q0E993_DROME Valine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=ValRS PE=1 SV=1
11	Q3U2A8	1793	1060	0.835	0.838	SYVM_MOUSE Valine--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Vars2 PE=1 SV=2
12	Q587B4	814	975	0.408	0.445	Q587B4_TRYB2 valine--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.26G9.740 PE=3 SV=1
13	Q5ST30	2162	1063	1.000	1.000	SYVM_HUMAN Valine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=VARS2 PE=1 SV=2
14	Q6FTE7	790	1105	0.378	0.364	Q6FTE7_CANGA valine--tRNA ligase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0G03091g PE=3 SV=1
15	Q72E47	560	884	0.336	0.404	SYV_DESVH Valine--tRNA ligase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=valS PE=1 SV=1
16	Q86KU2	884	1072	0.413	0.410	SYVC_DICDI Probable valine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum OX=44689 GN=valS1 PE=3 SV=1
17	Q960E6	937	1049	0.451	0.457	Q960E6_DROME Valine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=ValRS PE=2 SV=1
18	Q9U1Q4	893	1050	0.420	0.425	SYV_CAEEL Valine--tRNA ligase OS=Caenorhabditis elegans OX=6239 GN=glp-4 PE=1 SV=1
19	Q9VSR7	654	994	0.341	0.364	Q9VSR7_DROME valine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=ValRS-m PE=2 SV=1
20	Q9Z1Q9	979	1263	0.482	0.405	SYVC_MOUSE Valine--tRNA ligase OS=Mus musculus OX=10090 GN=Vars1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08264 Anticodon_1	7.6e-28	108.9	Anticodon-binding domain of tRNA ligase
2	PF09766 FmiP_Thoc5	75	14.1	Fms-interacting protein/Thoc5
3	PF00133 tRNA-synt_1	4.5e-177	601.6	tRNA synthetases class I (I, L, M and V)
4	PF00579 tRNA-synt_1b	2.1e+02	12.6	tRNA synthetases class I (W and Y)
5	PF01406 tRNA-synt_1e	6.3	17.6	tRNA synthetases class I (C) catalytic domain
6	PF01921 tRNA-synt_1f	1.9e+02	12.4	tRNA synthetases class I (K)
7	PF09334 tRNA-synt_1g	8.6e-12	56.1	tRNA synthetases class I (M)
8	PF13603 tRNA-synt_1_2	0.52	21.3	Leucyl-tRNA synthetase, Domain 2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000441000

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377954	0.993	Leucine--tRNA ligase, cytoplasmic
2	9606.ENSP00000355890	0.977	Bifunctional glutamate/proline--tRNA ligase
3	9606.ENSP00000307567	0.966	Glutamine--tRNA ligase
4	9606.ENSP00000364794	0.949	Isoleucine--tRNA ligase, cytoplasmic
5	9606.ENSP00000362576	0.931	Tyrosine--tRNA ligase, cytoplasmic
6	9606.ENSP00000261772	0.929	Alanine--tRNA ligase, cytoplasmic
7	9606.ENSP00000369897	0.917	Cysteine--tRNA ligase, cytoplasmic
8	9606.ENSP00000373918	0.909	Glycine--tRNA ligase
9	9606.ENSP00000387710	0.909	Threonine--tRNA ligase, cytoplasmic
10	9606.ENSP00000262027	0.901	Methionine--tRNA ligase, cytoplasmic
11	9606.ENSP00000360327	0.897	Probable proline--tRNA ligase, mitochondrial
12	9606.ENSP00000358060	0.891	Threonine--tRNA ligase, mitochondrial
13	9606.ENSP00000256854	0.884	Asparagine--tRNA ligase, cytoplasmic
14	9606.ENSP00000257347	0.879	Probable cysteine--tRNA ligase, mitochondrial
15	9606.ENSP00000281038	0.873	Probable asparagine--tRNA ligase, mitochondrial
16	9606.ENSP00000358549	0.873	Probable arginine--tRNA ligase, mitochondrial
17	9606.ENSP00000316335	0.872	Phenylalanine--tRNA ligase, mitochondrial
18	9606.ENSP00000320658	0.867	Tyrosine--tRNA ligase, mitochondrial
19	9606.ENSP00000395196	0.851	Probable glutamate--tRNA ligase, mitochondrial
20	9606.ENSP00000282276	0.844	Methionine--tRNA ligase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004812	1.000	aminoacyl-tRNA ligase activity
GO:0005515	0.997	protein binding
GO:0004832	0.824	valine-tRNA ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1901576	0.996	organic substance biosynthetic process
GO:0044260	0.996	cellular macromolecule metabolic process
GO:0019538	0.996	protein metabolic process
GO:0006139	0.996	nucleobase-containing compound metabolic process
GO:0010467	0.995	gene expression
GO:0044271	0.995	cellular nitrogen compound biosynthetic process
GO:0006418	0.987	tRNA aminoacylation for protein translation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005739	0.990	mitochondrion
GO:0043233	0.918	organelle lumen
GO:0070013	0.841	intracellular organelle lumen
GO:0005829	0.741	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.1.1.-	1.000	Ligases forming aminoacyl-tRNA and related compounds.
RHEA:10704	0.824	ATP + L-valine + tRNA(Val) = AMP + diphosphate + L-valyl-tRNA(Val)
EC:6.1.1.9	0.824	valine--tRNA ligase.

[back to server]