StarFunc result for job id Q5SVQ8

User Input

>input (909 residues)
MKKRRKVTSNLEKIHLGYHKDSSEGNVAVECDQVTYTHSAGRPTPEALHCYQELPPSPDQ
RKLLSSLQYNKNLLKYLNDDRQKQPSFCDLLIIVEGKEFSAHKVVVAVGSSYFHACLSKN
PSTDVVTLDHVTHSVFQHLLEFLYTSEFFVYKYEIPLVLEAAKFLDIIDAVKLLNNENVA
PFHSELTEKSSPEETLNELTGRLSNNHQCKFCSRHFCYKKSLENHLAKTHRSLLLGKKHG
LKMLERSFSARRSKRNRKCPVKFDDTSDDEQESGDGSDNLNQENFDKEKSDRNDSEDPGS
EYNAEEDELEEEMSDEYSDIEEQSEKDHNDAEEEPEAGDSVGNVHEGLTPVVIQNSNKKI
LQCPKCDKTFDRIGKYESHTRVHTGEKPFECDICHQRYSTKSNLTVHRKKHSNETEFHKK
EHKCPYCNKLHASKKTLAKHVKRFHPENAQEFISIKKTKSESWKCDICKKSFTRRPHLEE
HMILHSQDKPFKCTYCEEHFKSRFARLKHQEKFHLGPFPCDICGRQFNDTGNLKRHIECT
HGGKRKWTCFICGKSVRERTTLKEHLRIHSGEKPHLCSICGQSFRHGSSYRLHLRVHHDD
KRYECDECGKTFIRHDHLTKHKKIHSGEKAHQCEECGKCFGRRDHLTVHYKSVHLGEKVW
QKYKATFHQCDVCKKIFKGKSSLEMHFRTHSGEKPYKCQICNQSFRIKKTLTKHLVIHSD
ARPFNCQHCNATFKRKDKLKYHIDHVHEIKSPDDPLSTSEEKLVSLPVEYSSDDKIFQTE
TKQYMDQPKVYQSEAKTMLQNVSAEVCVPVTLVPVQMPDTPSDLVRHTTTLPPSSHEILS
PQPQSTDYPRAADLAFLEKYTLTPQPANIVHPVRPEQMLDPREQSYLGTLLGLDSTTGVQ
NISTNEHHS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P51814	0.162	0.176	2.134E-34	821	0.193	0.213	P51814.pdb.gz	ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens OX=9606 GN=ZNF41 PE=1 SV=2
2	AFDB:P10074	0.152	0.190	3.041E-34	688	0.190	0.251	P10074.pdb.gz	TZAP_HUMAN Telomere zinc finger-associated protein OS=Homo sapiens OX=9606 GN=ZBTB48 PE=1 SV=2
3	AFDB:Q02386	0.158	0.197	4.875E-34	682	0.180	0.240	Q02386.pdb.gz	ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens OX=9606 GN=ZNF45 PE=1 SV=2
4	AFDB:O95625	0.151	0.136	5.485E-34	1053	0.193	0.166	O95625.pdb.gz	ZBT11_HUMAN Zinc finger and BTB domain-containing protein 11 OS=Homo sapiens OX=9606 GN=ZBTB11 PE=1 SV=2
5	AFDB:A0A0U1RQ46	0.155	0.212	4.586E-33	609	0.163	0.243	A0A0U1RQ46.pdb.gz	A0A0U1RQ46_MOUSE Zinc finger protein 950 OS=Mus musculus OX=10090 GN=Zfp950 PE=4 SV=1
6	AFDB:P15622	0.153	0.232	1.047E-32	560	0.172	0.279	P15622.pdb.gz	ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens OX=9606 GN=ZNF250 PE=1 SV=3
7	AFDB:Q5DTF8	0.206	0.204	1.679E-32	919	0.178	0.176	Q5DTF8.pdb.gz	Q5DTF8_MOUSE MKIAA4236 protein (Fragment) OS=Mus musculus OX=10090 GN=Zfp748 PE=2 SV=1
8	AFDB:O75290	0.163	0.215	1.889E-32	641	0.178	0.253	O75290.pdb.gz	Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens OX=9606 GN=ZNF780A PE=1 SV=3
9	AFDB:P0CG24	0.141	0.300	3.835E-32	379	0.147	0.354	P0CG24.pdb.gz	ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens OX=9606 GN=ZNF883 PE=1 SV=1
10	AFDB:P52736	0.117	0.151	7.784E-32	654	0.183	0.254	P52736.pdb.gz	ZN133_HUMAN Zinc finger protein 133 OS=Homo sapiens OX=9606 GN=ZNF133 PE=1 SV=2
11	PDB:6wcqC	0.126	0.827	1.403E-8	130	0.032	0.223	6wcqC.pdb.gz
12	PDB:7mk2A	0.108	0.264	4.271E-4	354	0.026	0.068	7mk2A.pdb.gz	Structural basis of NPR1 in activating plant immunity.
13	PDB:3w5kB	0.060	0.260	4.530E-4	110	0.035	0.291	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
14	PDB:3ogkA	0.090	0.526	3.788E-3	145	0.021	0.131	3ogkA.pdb.gz	Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor.
15	PDB:2p1nD	0.084	0.561	1.561E-2	127	0.020	0.142	2p1nD.pdb.gz	Mechanism of auxin perception by the TIR1 ubiquitin ligase
16	PDB:5vztA	0.089	0.521	2.654E-2	145	0.023	0.145	5vztA.pdb.gz	Structural basis of the phosphorylation-independent recognition of cyclin D1 by the SCFFBXO31 ubiquitin ligase.
17	PDB:6gypD	0.088	0.465	2.815E-2	151	0.030	0.179	6gypD.pdb.gz	Architecture of the CBF3-centromere complex of the budding yeast kinetochore.
18	PDB:7phhA	0.074	0.162	3.564E-2	396	0.022	0.051	7phhA.pdb.gz
19	PDB:2a79B	0.083	0.261	4.010E-2	259	0.012	0.042	2a79B.pdb.gz	Crystal structure of a mammalian voltage-dependent Shaker family K+ channel.
20	PDB:3lutB	0.090	0.196	5.078E-2	390	0.019	0.044	3lutB.pdb.gz	Structure of the full-length Shaker potassium channel Kv1.2 by normal-mode-based X-ray crystallographic refinement.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P51522	4.21e-71	246	516	0.161	0.283	ZNF83_HUMAN Zinc finger protein 83 OS=Homo sapiens OX=9606 GN=ZNF83 PE=2 SV=3
2	P15622	2.57e-70	245	560	0.156	0.254	ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens OX=9606 GN=ZNF250 PE=1 SV=3
3	Q9BX82	4.72e-70	246	626	0.155	0.225	ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens OX=9606 GN=ZNF471 PE=2 SV=1
4	Q8IYB9	6.16e-70	246	648	0.169	0.238	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2
5	Q9P2J8	8.55e-70	250	865	0.164	0.172	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
6	Q02386	8.87e-70	247	682	0.158	0.211	ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens OX=9606 GN=ZNF45 PE=1 SV=2
7	P51523	2.38e-69	247	738	0.165	0.203	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
8	Q6ECI4	2.69e-69	246	717	0.155	0.197	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
9	Q9NQZ8	2.70e-69	240	489	0.156	0.290	ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens OX=9606 GN=ZNF71 PE=1 SV=1
10	O75437	3.16e-69	244	659	0.164	0.226	ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens OX=9606 GN=ZNF254 PE=2 SV=3
11	Q14585	4.63e-69	239	488	0.151	0.281	ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens OX=9606 GN=ZNF345 PE=1 SV=1
12	P15620	6.21e-69	242	580	0.161	0.252	ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus OX=10090 GN=Znf271 PE=2 SV=1
13	Q9P0L1	1.02e-68	245	754	0.165	0.199	ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens OX=9606 GN=ZKSCAN7 PE=1 SV=2
14	Q6ZN57	1.63e-68	237	461	0.153	0.302	ZFP2_HUMAN Zinc finger protein ZFP2 OS=Homo sapiens OX=9606 GN=ZFP2 PE=1 SV=1
15	Q6NX49	3.01e-68	243	715	0.155	0.197	ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens OX=9606 GN=ZNF544 PE=1 SV=1
16	Q5TYW1	7.24e-68	248	1059	0.162	0.139	ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens OX=9606 GN=ZNF658 PE=1 SV=2
17	P17027	1.10e-67	240	643	0.155	0.219	ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens OX=9606 GN=ZNF23 PE=1 SV=3
18	P35789	2.08e-67	239	620	0.157	0.231	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
19	P17020	2.29e-67	240	682	0.150	0.199	ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens OX=9606 GN=ZNF16 PE=1 SV=3
20	A6NNF4	5.89e-67	237	616	0.158	0.234	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00651 BTB	7e-17	73.0	BTB/POZ domain
2	PF19126 DUF5810	2.4e+02	13.2	Family of unknown function (DUF5810)
3	PF09237 GAGA	4.8e+02	12.2	GAGA factor
4	PF02892 zf-BED	3e+02	12.8	BED zinc finger
5	PF00096 zf-C2H2	1.2e-40	146.9	Zinc finger, C2H2 type
6	PF13894 zf-C2H2_4	2.3e-29	110.5	C2H2-type zinc finger
7	PF13912 zf-C2H2_6	0.00016	32.9	C2H2-type zinc finger
8	PF12171 zf-C2H2_jaz	0.52	21.9	Zinc-finger double-stranded RNA-binding
9	PF13913 zf-C2HC_2	2.9e+02	12.8	zinc-finger of a C2HC-type
10	PF13465 zf-H2C2_2	1.6e-43	156.5	Zinc-finger double domain
11	PF12874 zf-met	0.0037	28.8	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356375

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000287859	0.779	Protein odr-4 homolog
2	9606.ENSP00000369979	0.746	Probable carboxypeptidase X1
3	9606.ENSP00000356481	0.724	Protein Niban
4	9606.ENSP00000340975	0.682	Ankyrin repeat domain-containing protein SOWAHD
5	9606.ENSP00000236925	0.607	Calmodulin-regulated spectrin-associated protein 2
6	9606.ENSP00000277903	0.577	Hyaluronan-binding protein 2
7	9606.ENSP00000219066	0.554	Endonuclease III-like protein 1
8	9606.ENSP00000356399	0.539	Complement factor H
9	9606.ENSP00000356386	0.532	Complement factor H-related protein 4
10	9606.ENSP00000379621	0.520	Sorting nexin-16
11	9606.ENSP00000356385	0.508	Complement factor H-related 2
12	9606.ENSP00000356391	0.508	Complement factor H-related protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1901363	0.996	heterocyclic compound binding
GO:0097159	0.995	organic cyclic compound binding
GO:0003676	0.980	nucleic acid binding
GO:0003677	0.969	DNA binding
GO:0003690	0.686	double-stranded DNA binding
GO:1990837	0.607	sequence-specific double-stranded DNA binding
GO:0140110	0.418	transcription regulator activity
GO:0003700	0.384	DNA-binding transcription factor activity
GO:0000976	0.358	transcription cis-regulatory region binding
GO:0000981	0.342	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.988	biological regulation
GO:0050789	0.974	regulation of biological process
GO:0060255	0.916	regulation of macromolecule metabolic process
GO:0031323	0.905	regulation of cellular metabolic process
GO:0009987	0.884	cellular process
GO:0051171	0.859	regulation of nitrogen compound metabolic process
GO:0080090	0.804	regulation of primary metabolic process
GO:0019219	0.725	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.549	regulation of gene expression
GO:0050896	0.530	response to stimulus
GO:0009889	0.522	regulation of biosynthetic process
GO:0048519	0.392	negative regulation of biological process
GO:0010556	0.370	regulation of macromolecule biosynthetic process
GO:0031326	0.363	regulation of cellular biosynthetic process
GO:0071704	0.328	organic substance metabolic process
GO:0006355	0.326	regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.989	nuclear lumen
GO:0005654	0.984	nucleoplasm
GO:0043232	0.448	intracellular non-membrane-bounded organelle
GO:0005737	0.416	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]