StarFunc result for job id Q5SVZ6

User Input

>input (1142 residues)
MKEPLLGGECDKAVASQLGLLDEIKTEPDNAQEYCHRQQSRTQENELKINAVFSESASQL
TAGIQLSLASSGVNKMLPSVSTTAIQVSCAGCKKILQKGQTAYQRKGSAQLFCSIPCITE
YISSASSPVPSKRTCSNCSKDILNPKDVISVQLEDTTSCKTFCSLSCLSSYEEKRKPFVT
ICTNSILTKCSMCQKTAIIQYEVKYQNVKHNLCSNACLSKFHSANNFIMNCCENCGTYCY
TSSSLSHILQMEGQSHYFNSSKSITAYKQKPAKPLISVPCKPLKPSDEMIETTSDLGKTE
LFCSINCFSAYSKAKMESSSVSVVSVVHDTSTELLSPKKDTTPVISNIVSLADTDVALPI
MNTDVLQDTVSSVTATADVIVDLSKSSPSEPSNAVASSSTEQPSVSPSSSVFSQHAIGSS
TEVQKDNMKSMKISDELCHPKCTSKVQKVKGKSRSIKKSCCADFECLENSKKDVAFCYSC
QLFCQKYFSCGRESFATHGTSNWKKTLEKFRKHEKSEMHLKSLEFWREYQFCDGAVSDDL
SIHSKQIEGNKKYLKLIIENILFLGKQCLPLRGNDQSVSSVNKGNFLELLEMRAKDKGEE
TFRLMNSQVDFYNSTQIQSDIIEIIKTEMLQDIVNEINDSSAFSIICDETINSAMKEQLS
ICVRYPQKSSKAILIKERFLGFVDTEEMTGTHLHRTIKTYLQQIGVDMDKIHGQAYDSTT
NLKIKFNKIAAEFKKEEPRALYIHCYAHFLDLSIIRFCKEVKELRSALKTLSSLFNTICM
SGEMLANFRNIYRLSQNKTCKKHISQSCWTVHDRTLLSVIDSLPEIIETLEVIASHSSNT
SFADELSHLLTLVSKFEFVFCLKFLYRVLSVTGILSKELQNKTIDIFSLSSKIEAILECL
SSERNDVYFKTIWDGTEEICQKITCKGFKVEKPSLQKRRKIQKSVDLGNSDNMFFPTSTE
EQYKINIYYQGLDTILQNLKLCFSEFDYCKIKQISELLFKWNEPLNETTAKHVQEFYKLD
EDIIPELRFYRHYAKLNFVIDDSCINFVSLGCLFIQHGLHSNIPCLSKLLYIALSWPITS
ASTENSFSTLPRLKTYLCNTMGQEKLTGPALMAVEQELVNKLMEPERLNEIVEKFISQMK
EI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95789	0.361	0.319	2.418E-39	1325	0.292	0.252	O95789.pdb.gz	ZMYM6_HUMAN Zinc finger MYM-type protein 6 OS=Homo sapiens OX=9606 GN=ZMYM6 PE=1 SV=2
2	AFDB:O54988	0.043	0.040	1.413E-2	1233	0.116	0.107	O54988.pdb.gz	SLK_MOUSE STE20-like serine/threonine-protein kinase OS=Mus musculus OX=10090 GN=Slk PE=1 SV=2
3	AFDB:F4K0Y5	0.079	0.078	1.544E-2	1165	0.119	0.117	F4K0Y5.pdb.gz	F4K0Y5_ARATH Heat shock protein DnaJ with tetratricopeptide repeat-containing protein OS=Arabidopsis thaliana OX=3702 GN=TPR16 PE=1 SV=1
4	AFDB:O08815	0.037	0.036	2.411E-2	1206	0.102	0.096	O08815.pdb.gz	SLK_RAT STE20-like serine/threonine-protein kinase OS=Rattus norvegicus OX=10116 GN=Slk PE=1 SV=1
5	AFDB:B8PWL7	0.064	0.072	2.520E-2	994	0.130	0.150	B8PWL7.pdb.gz	B8PWL7_DANRE Disrupted in schizophrenia 1 OS=Danio rerio OX=7955 GN=disc1 PE=2 SV=1
6	PDB:3idhA	0.082	0.162	2.727E-2	453	0.028	0.071	3idhA.pdb.gz	The active conformation of human glucokinase is not altered by allosteric activators
7	AFDB:Q9P2D8	0.074	0.044	2.755E-2	2635	0.124	0.054	Q9P2D8.pdb.gz	UNC79_HUMAN Protein unc-79 homolog OS=Homo sapiens OX=9606 GN=UNC79 PE=1 SV=4
8	AFDB:Q8IN89	0.060	0.066	3.012E-2	984	0.126	0.146	Q8IN89.pdb.gz	Q8IN89_DROME Well-rounded, isoform B OS=Drosophila melanogaster OX=7227 GN=wrd PE=1 SV=1
9	AFDB:Q54DW4	0.067	0.061	3.149E-2	1350	0.136	0.115	Q54DW4.pdb.gz	Q54DW4_DICDI Pleckstrin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=xacA PE=4 SV=1
10	AFDB:D3Z881	0.057	0.055	3.442E-2	1245	0.142	0.130	D3Z881.pdb.gz	D3Z881_RAT TBC1 domain family, member 4 OS=Rattus norvegicus OX=10116 GN=Tbc1d4 PE=1 SV=4
11	PDB:4krfA	0.065	0.087	4.071E-2	817	0.012	0.017	4krfA.pdb.gz	The making of a slicer: activation of human argonaute-1.
12	PDB:6oonA	0.064	0.088	6.645E-2	785	0.008	0.011	6oonA.pdb.gz	Multidomain Convergence of Argonaute during RISC Assembly Correlates with the Formation of Internal Water Clusters.
13	AFDB:M9PGK7	0.064	0.040	6.714E-2	2272	0.133	0.067	M9PGK7.pdb.gz	M9PGK7_DROME Klarsicht, isoform E OS=Drosophila melanogaster OX=7227 GN=klar PE=1 SV=1
14	PDB:2ygkA	0.060	0.153	8.302E-2	319	0.016	0.056	2ygkA.pdb.gz	Structural and Functional Insights Into DNA-End Processing by the Archaeal Hera Helicase-Nura Nuclease Complex.
15	PDB:2ivnA	0.063	0.188	1.134E-1	325	0.017	0.058	2ivnA.pdb.gz	An Archaeal Orthologue of the Universal Protein Kae1 is an Iron Metalloprotein which Exhibits Atypical DNA-Binding Properties and Apurinic-Endonuclease Activity in Vitro.
16	PDB:5guhA	0.066	0.094	1.134E-1	759	0.009	0.013	5guhA.pdb.gz	Crystal Structure of Silkworm PIWI-Clade Argonaute Siwi Bound to piRNA
17	PDB:6ob7A	0.060	0.118	1.296E-1	381	0.042	0.126	6ob7A.pdb.gz	Structures of human ENT1 in complex with adenosine reuptake inhibitors.
18	PDB:5vm9C	0.063	0.087	1.355E-1	785	0.007	0.010	5vm9C.pdb.gz	Human Argonaute3 has slicer activity.
19	PDB:1u6zB	0.088	0.169	1.549E-1	500	0.029	0.066	1u6zB.pdb.gz
20	PDB:7rroD1	0.035	0.073	2.115E-1	425	0.044	0.118	7rroD1.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5VZL5	7.53e-122	412	1548	0.190	0.140	ZMYM4_HUMAN Zinc finger MYM-type protein 4 OS=Homo sapiens OX=9606 GN=ZMYM4 PE=1 SV=1
2	O95789	1.76e-107	369	1325	0.191	0.165	ZMYM6_HUMAN Zinc finger MYM-type protein 6 OS=Homo sapiens OX=9606 GN=ZMYM6 PE=1 SV=2
3	F4IE28	1.07e-47	186	769	0.183	0.272	F4IE28_ARATH TTF-type zinc finger protein with HAT dimerization domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=LOH3 PE=4 SV=1
4	A6NHB5	7.53e-40	163	1372	0.082	0.069	A6NHB5_HUMAN Zinc finger MYM-type containing 3 OS=Homo sapiens OX=9606 GN=ZMYM3 PE=1 SV=1
5	Q14202	7.72e-40	163	1370	0.082	0.069	ZMYM3_HUMAN Zinc finger MYM-type protein 3 OS=Homo sapiens OX=9606 GN=ZMYM3 PE=1 SV=2
6	A6NHN7	8.46e-40	163	1280	0.082	0.073	A6NHN7_HUMAN Zinc finger MYM-type containing 3 OS=Homo sapiens OX=9606 GN=ZMYM3 PE=1 SV=1
7	Q9JLM4	2.31e-39	162	1370	0.085	0.071	ZMYM3_MOUSE Zinc finger MYM-type protein 3 OS=Mus musculus OX=10090 GN=Zmym3 PE=1 SV=1
8	Q9CU65	1.36e-38	159	1376	0.072	0.060	ZMYM2_MOUSE Zinc finger MYM-type protein 2 OS=Mus musculus OX=10090 GN=Zmym2 PE=1 SV=3
9	Q9UBW7	1.79e-38	159	1377	0.075	0.062	ZMYM2_HUMAN Zinc finger MYM-type protein 2 OS=Homo sapiens OX=9606 GN=ZMYM2 PE=1 SV=1
10	A6NL54	5.07e-36	145	497	0.068	0.157	A6NL54_HUMAN Zinc finger MYM-type containing 3 OS=Homo sapiens OX=9606 GN=ZMYM3 PE=1 SV=1
11	Q9UJ78	1.35e-30	131	669	0.069	0.118	ZMYM5_HUMAN Zinc finger MYM-type protein 5 OS=Homo sapiens OX=9606 GN=ZMYM5 PE=1 SV=4
12	Q9CUX1	1.59e-29	129	758	0.133	0.201	P52K_MOUSE 52 kDa repressor of the inhibitor of the protein kinase OS=Mus musculus OX=10090 GN=Thap12 PE=2 SV=2
13	O43422	1.74e-29	129	761	0.134	0.201	P52K_HUMAN 52 kDa repressor of the inhibitor of the protein kinase OS=Homo sapiens OX=9606 GN=THAP12 PE=1 SV=2
14	Q95TK6	1.58e-08	61.6	1043	0.047	0.052	Q95TK6_DROME LD44304p OS=Drosophila melanogaster OX=7227 GN=woc PE=2 SV=1
15	A0A0B4KHZ0	2.64e-08	60.8	1702	0.033	0.022	A0A0B4KHZ0_DROME Without children, isoform E OS=Drosophila melanogaster OX=7227 GN=woc PE=1 SV=1
16	A0A0B4KI43	2.68e-08	60.8	1687	0.033	0.023	A0A0B4KI43_DROME Without children, isoform D OS=Drosophila melanogaster OX=7227 GN=woc PE=1 SV=1
17	Q6AWL3	2.73e-08	60.8	1688	0.033	0.023	Q6AWL3_DROME RE05635p OS=Drosophila melanogaster OX=7227 GN=woc PE=2 SV=1
18	A8JRE3	2.75e-08	60.8	1703	0.033	0.022	A8JRE3_DROME Without children, isoform B OS=Drosophila melanogaster OX=7227 GN=woc PE=1 SV=1
19	Q9VB55	2.75e-08	60.8	1688	0.033	0.023	Q9VB55_DROME Without children, isoform A OS=Drosophila melanogaster OX=7227 GN=woc PE=1 SV=2
20	Q9N9Z6	2.99e-08	60.8	1688	0.033	0.023	Q9N9Z6_DROME WOC protein OS=Drosophila melanogaster OX=7227 GN=woc PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05699 Dimer_Tnp_hAT	2.1e-13	61.2	hAT family C-terminal dimerisation region
2	PF14291 DUF4371	4.1e-31	119.9	Domain of unknown function (DUF4371)
3	PF00160 Pro_isomerase	1e+02	14.6	Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD
4	PF06467 zf-FCS	2e-20	83.8	MYM-type Zinc finger with FCS sequence motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9544.ENSMMUP00000021651

Rank	PPI partner	STRING score	Description
1	9544.ENSMMUP00000014850	0.608	Potassium channel tetramerization domain containing 15
2	9544.ENSMMUP00000021589	0.577	CCAAT/enhancer binding protein (C/EBP), zeta
3	9544.ENSMMUP00000026671	0.572	Paraspeckle component 1
4	9544.ENSMMUP00000006106	0.570	Uncharacterized protein
5	9544.ENSMMUP00000011157	0.504	THAP domain-containing protein 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.997	nucleic acid binding
GO:0003677	0.994	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.990	biological regulation
GO:0050789	0.980	regulation of biological process
GO:0009987	0.965	cellular process
GO:0050794	0.826	regulation of cellular process
GO:0071704	0.432	organic substance metabolic process
GO:0043170	0.383	macromolecule metabolic process
GO:0044237	0.331	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0005737	0.411	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]