StarFunc result for job id Q5SW24

User Input

>input (774 residues)
MWTPGGPPGSAGWDRRRLGARLRAAFAGLQELQGLRATQQERVRGALALQPPPAPAAPCG
PHGLHGPEQQLEAALAALQEQLSRLRQQDIGLKTHLDQLDLQISKLQLDVGTASGEALDS
DSRPSSGFYEMSDGGSCSLSTSCASVCSDHISPSLGSLLPVAQAHKARPSMGDWRPRSVD
ETTVPAWRPQATEEGARPPGSVEDAGQPWGTFWPRPVSTGDLDRALPADTGLQKASADAE
LLGLLCQGVDIPLHVPDPKYRQDLVSQGGREVYPYPSPLHAVALQSPLFVLTKETPQRGG
PSFPRESPRGPAGLNTIQTGPVLEAGPARARAYIDRLLHLWGRETPAKGSEGEQGPLRHA
ASPSPQRQGGWSTDGGGRLLVFAPGREDEGGPAQSRGAGRGGPQQQGYMPLEGPQQSGSL
PEEGSKPSNSCVLRETMVQASPSSKAQQTPSAQDYGRGNIISPSRMLDKSPSPASGHFAH
PSFAASLKMGPPKSKAEKIKRSPMDKVLRFARQPLLLLDRPEGAHAAPQPSLEWDPAHWP
TGRGGLQRRPALAWEAPGRSCSESTLYPMPVLVPLAVAPQESHRTSAQALFPFEASLLTS
VARRKHRRWQSTVEISARARLASCPESNLGPPRPVARRAGGPLARGRPSLVRQDAYTRSD
SEPSKHSAECDPRFPSVIPETSEGESSDHTTNRFGDRESSSSDEEGGAQSRDCDLALGYV
AAGHAELAWTQEAPVSSGPLLSPVPKLCRIKASKALKKKIRRFQPTALKVMTMV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5SW24	0.999	0.999	0.000	774	1.000	1.000	Q5SW24.pdb.gz	DACT2_HUMAN Dapper homolog 2 OS=Homo sapiens OX=9606 GN=DACT2 PE=1 SV=1
2	AFDB:Q7TN08	0.111	0.113	9.502E-51	757	0.567	0.580	Q7TN08.pdb.gz	DACT2_MOUSE Dapper homolog 2 OS=Mus musculus OX=10090 GN=Dact2 PE=1 SV=2
3	AFDB:Q6QZN6	0.102	0.098	7.344E-18	821	0.265	0.250	Q6QZN6.pdb.gz	DACT1_DANRE Dapper homolog 1 OS=Danio rerio OX=7955 GN=dact1 PE=1 SV=1
4	AFDB:Q9NYF0	0.131	0.123	3.267E-17	836	0.310	0.287	Q9NYF0.pdb.gz	DACT1_HUMAN Dapper homolog 1 OS=Homo sapiens OX=9606 GN=DACT1 PE=1 SV=2
5	AFDB:Q96B18	0.098	0.115	5.188E-9	629	0.242	0.297	Q96B18.pdb.gz	DACT3_HUMAN Dapper homolog 3 OS=Homo sapiens OX=9606 GN=DACT3 PE=1 SV=2
6	AFDB:Q9VZZ9	0.072	0.065	9.990E-3	878	0.142	0.125	Q9VZZ9.pdb.gz	DOS_DROME Protein daughter of sevenless OS=Drosophila melanogaster OX=7227 GN=dos PE=1 SV=1
7	AFDB:Q8T9B8	0.064	0.058	2.644E-2	874	0.136	0.120	Q8T9B8.pdb.gz	Q8T9B8_DROME SD08060p OS=Drosophila melanogaster OX=7227 GN=Brd8 PE=2 SV=1
8	AFDB:Q6FWW9	0.057	0.054	4.444E-2	823	0.118	0.111	Q6FWW9.pdb.gz	Q6FWW9_CANGA Candida glabrata strain CBS138 chromosome C complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=GLN3 PE=4 SV=1
9	AFDB:Q9VF00	0.062	0.064	4.444E-2	746	0.149	0.154	Q9VF00.pdb.gz	Q9VF00_DROME GATAe, isoform A OS=Drosophila melanogaster OX=7227 GN=GATAe PE=2 SV=2
10	AFDB:O74653	0.040	0.036	9.073E-2	871	0.137	0.122	O74653.pdb.gz	POB1_SCHPO Protein pob1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pob1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5SW24	0.0	1540	774	1.000	1.000	DACT2_HUMAN Dapper homolog 2 OS=Homo sapiens OX=9606 GN=DACT2 PE=1 SV=1
2	Q7TN08	0.0	676	757	0.568	0.581	DACT2_MOUSE Dapper homolog 2 OS=Mus musculus OX=10090 GN=Dact2 PE=1 SV=2
3	Q673G8	7.34e-49	187	837	0.180	0.166	DACT2_DANRE Dapper homolog 2 OS=Danio rerio OX=7955 GN=dact2 PE=1 SV=2
4	Q8QG92	4.54e-26	117	824	0.128	0.120	DCT1B_XENLA Dapper 1-B OS=Xenopus laevis OX=8355 GN=dact1-b PE=1 SV=1
5	Q9NYF0	1.11e-25	115	836	0.141	0.130	DACT1_HUMAN Dapper homolog 1 OS=Homo sapiens OX=9606 GN=DACT1 PE=1 SV=2
6	Q8JJ48	3.17e-18	92.0	818	0.070	0.066	DCT1A_XENLA Dapper 1-A OS=Xenopus laevis OX=8355 GN=dact1-a PE=1 SV=1
7	Q8R4A3	1.87e-17	89.4	778	0.078	0.077	DACT1_MOUSE Dapper homolog 1 OS=Mus musculus OX=10090 GN=Dact1 PE=1 SV=1
8	Q6QZN6	4.45e-17	88.2	821	0.070	0.066	DACT1_DANRE Dapper homolog 1 OS=Danio rerio OX=7955 GN=dact1 PE=1 SV=1
9	B7Z673	1.14e-14	80.1	555	0.089	0.124	B7Z673_HUMAN Dishevelled binding antagonist of beta catenin 1 OS=Homo sapiens OX=9606 GN=DACT1 PE=1 SV=1
10	Q96B18	0.099	38.5	629	0.023	0.029	DACT3_HUMAN Dapper homolog 3 OS=Homo sapiens OX=9606 GN=DACT3 PE=1 SV=2
11	Q0PHV7	0.11	38.5	610	0.023	0.030	DACT3_MOUSE Dapper homolog 3 OS=Mus musculus OX=10090 GN=Dact3 PE=1 SV=1
12	D3ZJ47	5.8	32.7	917	0.085	0.072	MNAR1_RAT Major intrinsically disordered Notch2-binding receptor 1 OS=Rattus norvegicus OX=10116 GN=Minar1 PE=2 SV=3
13	E9PV87	7.5	32.7	1520	0.021	0.011	TALD3_MOUSE Protein TALPID3 OS=Mus musculus OX=10090 GN=Talpid3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15268 Dapper	2.5e-241	815.7	Dapper

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355760

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000375783	0.859	Dapper homolog 3
2	9606.ENSP00000346537	0.785	SPARC-related modular calcium-binding protein 2
3	9606.ENSP00000442656	0.741	Activin receptor type-1B
4	9606.ENSP00000341805	0.655	PHD finger protein 10
5	9606.ENSP00000364133	0.652	TGF-beta receptor type-1
6	9606.ENSP00000005340	0.627	Segment polarity protein dishevelled homolog DVL-2
7	9606.ENSP00000355736	0.611	Tctex1 domain-containing protein 3
8	9606.ENSP00000283309	0.608	FERM domain containing 1
9	9606.ENSP00000440125	0.587	Constitutive coactivator of peroxisome proliferator-activated receptor gamma
10	9606.ENSP00000357040	0.585	Vang-like protein 2
11	9606.ENSP00000416289	0.557	WD repeat-containing protein 27
12	9606.ENSP00000355751	0.546	Thrombospondin-2
13	9606.ENSP00000368169	0.531	Segment polarity protein dishevelled homolog DVL-1
14	9606.ENSP00000344456	0.514	Catenin beta-1
15	9606.ENSP00000340526	0.512	Urotensin-2B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.392	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0009987	0.988	cellular process
GO:0048523	0.988	negative regulation of cellular process
GO:0048856	0.986	anatomical structure development
GO:0023051	0.976	regulation of signaling
GO:0010646	0.976	regulation of cell communication
GO:0009966	0.974	regulation of signal transduction
GO:0009888	0.967	tissue development
GO:0009968	0.958	negative regulation of signal transduction
GO:0030154	0.842	cell differentiation
GO:0009653	0.756	anatomical structure morphogenesis
GO:0032501	0.705	multicellular organismal process
GO:0007275	0.636	multicellular organism development
GO:0060429	0.629	epithelium development
GO:0090092	0.629	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0048731	0.547	system development
GO:0032925	0.536	regulation of activin receptor signaling pathway
GO:0030855	0.436	epithelial cell differentiation
GO:0002064	0.431	epithelial cell development
GO:0048518	0.423	positive regulation of biological process
GO:0048513	0.399	animal organ development
GO:0000902	0.394	cell morphogenesis
GO:0019222	0.393	regulation of metabolic process
GO:0048522	0.381	positive regulation of cellular process
GO:0060255	0.367	regulation of macromolecule metabolic process
GO:0035295	0.364	tube development
GO:0043588	0.356	skin development
GO:0090101	0.339	negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0050896	0.325	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005739	0.973	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]