StarFunc result for job id Q5SW79

User Input

>input (1584 residues)
MSLTSWFLVSSGGTRHRLPREMIFVGRDDCELMLQSRSVDKQHAVINYDASTDEHLVKDL
GSLNGTFVNDVRIPEQTYITLKLEDKLRFGYDTNLFTVVQGEMRVPEEALKHEKFTIQLQ
LSQKSSESELSKSASAKSIDSKVADAATEVQHKTTEALKSEEKAMDISAMPRGTPLYGQP
SWWGDDEVDEKRAFKTNGKPEEKNHEAGTSGCGIDAKQVEEQSAAANEEVLFPFCREPSY
FEIPTKEFQQPSQITESTIHEIPTKDTPSSHITGAGHASFTIEFDDSTPGKVTIRDHVTK
FTSDQRHKSKKSSPGTQDLLGIQTGMMAPENKVADWLAQNNPPQMLWERTEEDSKSIKSD
VPVYLKRLKGNKHDDGTQSDSENAGAHRRCSKRATLEEHLRRHHSEHKKLQKVQATEKHQ
DQAVTSSAHHRGGHGVPHGKLLKQKSEEPSVSIPFLQTALLRSSGSLGHRPSQEMDKMLK
NQATSATSEKDNDDDQSDKGTYTIELENPNSEEVEARKMIDKVFGVDDNQDYNRPVINEK
HKDLIKDWALSSAAAVMEERKPLTTSGFHHSEEGTSSSGSKRWVSQWASLAANHTRHDQE
ERIMEFSAPLPLENETEISESGMTVRSTGSATSLASQGERRRRTLPQLPNEEKSLESHRA
KVVTQRSEIGEKQDTELQEKETPTQVYQKDKQDADRPLSKMNRAVNGETLKTGGDNKTLL
HLGSSAPGKEKSETDKETSLVKQTLAKLQQQEQREEAQWTPTKLSSKNVSGQTDKCREET
FKQESQPPEKNSGHSTSKGDRVAQSESKRRKAEEILKSQTPKGGDKKESSKSLVRQGSFT
IEKPSPNIPIELIPHINKQTSSTPSSLALTSASRIRERSESLDPDSSMDTTLILKDTEAV
MAFLEAKLREDNKTDEGPDTPSYNRDNSISPESDVDTASTISLVTGETERKSTQKRKSFT
SLYKDRCSTGSPSKDVTKSSSSGAREKMEKKTKSRSTDVGSRADGRKFVQSSGRIRQPSV
DLTDDDQTSSVPHSAISDIMSSDQETYSCKPHGRTPLTSADEHVHSKLEGSKVTKSKTSP
VVSGSSSKSTTLPRPRPTRTSLLRRARLGEASDSELADADKASVASEVSTTSSTSKPPTG
RRNISRIDLLAQPRRTRLGSLSARSDSEATISRSSASSRTAEAIIRSGARLVPSDKFSPR
IRANSISRLSDSKVKSMTSAHGSASVNSRWRRFPTDYASTSEDEFGSNRNSPKHTRLRTS
PALKTTRLQSAGSAMPTSSSFKHRIKEQEDYIRDWTAHREEIARISQDLALIAREINDVA
GEIDSVTSSGTAPSTTVSTAATTPGSAIDTREELVDRVFDESLNFRKIPPLVHSKTPEGN
NGRSGDPRPQAAEPPDHLTITRRRTWSRDEVMGDNLLLSSVFQFSKKIRQSIDKTAGKIR
ILFKDKDRNWDDIESKLRAESEVPIVKTSSMEISSILQELKRVEKQLQAINAMIDPDGTL
EALNNMGFPSAMLPSPPKQKSSPVNNHHSPGQTPTLGQPEARALHPAAVSAAAEFENAES
EADFSIHFNRFNPDGEEEDVTVQE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5SW79	1.000	1.000	0.000	1584	1.000	1.000	Q5SW79.pdb.gz	CE170_HUMAN Centrosomal protein of 170 kDa OS=Homo sapiens OX=9606 GN=CEP170 PE=1 SV=1
2	AFDB:Q6A065	0.266	0.265	0.000	1588	0.890	0.888	Q6A065.pdb.gz	CE170_MOUSE Centrosomal protein of 170 kDa OS=Mus musculus OX=10090 GN=Cep170 PE=1 SV=2
3	AFDB:Q9Y4F5	0.102	0.102	4.140E-61	1589	0.342	0.340	Q9Y4F5.pdb.gz	C170B_HUMAN Centrosomal protein of 170 kDa protein B OS=Homo sapiens OX=9606 GN=CEP170B PE=1 SV=4
4	AFDB:B7SY83	0.073	0.077	2.623E-10	1477	0.141	0.152	B7SY83.pdb.gz	PS1_ARATH FHA domain-containing protein PS1 OS=Arabidopsis thaliana OX=3702 GN=PS1 PE=2 SV=1
5	PDB:7dvqX	0.058	0.534	1.450E-8	156	0.018	0.186	7dvqX.pdb.gz	Structure of the activated human minor spliceosome.
6	AFDB:O96685	0.057	0.071	1.765E-8	1261	0.107	0.135	O96685.pdb.gz	O96685_DROME Mutator 2 OS=Drosophila melanogaster OX=7227 GN=mu2 PE=1 SV=1
7	PDB:2ff4A	0.055	0.225	3.612E-7	379	0.017	0.071	2ff4A.pdb.gz	Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis.
8	AFDB:Q95RC8	0.058	0.070	4.397E-7	1280	0.112	0.138	Q95RC8.pdb.gz	Q95RC8_DROME LD44171p OS=Drosophila melanogaster OX=7227 GN=mu2 PE=1 SV=1
9	AFDB:Q5PSV9	0.065	0.061	4.662E-7	1707	0.158	0.146	Q5PSV9.pdb.gz	MDC1_MOUSE Mediator of DNA damage checkpoint protein 1 OS=Mus musculus OX=10090 GN=Mdc1 PE=1 SV=1
10	PDB:5gm6U	0.060	0.503	6.112E-7	176	0.020	0.176	5gm6U.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
11	PDB:5z56X	0.060	0.523	8.680E-7	159	0.015	0.151	5z56X.pdb.gz	Structure of the human activated spliceosome in three conformational states.
12	AFDB:Q14676	0.067	0.053	1.120E-6	2089	0.152	0.115	Q14676.pdb.gz	MDC1_HUMAN Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1 PE=1 SV=3
13	AFDB:E2QD98	0.042	0.034	6.105E-6	2020	0.137	0.107	E2QD98.pdb.gz	E2QD98_DROME Stardust, isoform G OS=Drosophila melanogaster OX=7227 GN=sdt PE=1 SV=1
14	PDB:7wrgA	0.054	0.103	3.792E-4	812	0.009	0.017	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
15	PDB:7wrgB	0.053	0.106	5.710E-4	783	0.010	0.020	7wrgB.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
16	PDB:6l9wD	0.059	0.550	1.543E-3	142	0.011	0.120	6l9wD.pdb.gz
17	AFDB:D3Z8E6	0.042	0.042	4.016E-3	1604	0.119	0.117	D3Z8E6.pdb.gz	CAMP1_RAT Calmodulin-regulated spectrin-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Camsap1 PE=1 SV=2
18	PDB:4qd2B	0.040	0.221	2.353E-1	143	0.009	0.098	4qd2B.pdb.gz	Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex.
19	PDB:6u426U	0.032	0.065	2.353E-1	569	0.010	0.028	6u426U.pdb.gz	Structure of the Decorated Ciliary Doublet Microtubule.
20	PDB:5ejgC	0.049	0.268	2.645E-1	218	0.004	0.032	5ejgC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7EMW0	0.0	634	320	0.196	0.969	E7EMW0_HUMAN Centrosomal protein 170 OS=Homo sapiens OX=9606 GN=CEP170 PE=1 SV=1
2	E7EWM2	0.0	599	293	0.185	1.000	E7EWM2_HUMAN Centrosomal protein 170 OS=Homo sapiens OX=9606 GN=CEP170 PE=1 SV=1
3	H0Y2V6	0.0	2916	1558	0.922	0.937	H0Y2V6_HUMAN Centrosomal protein 170 (Fragment) OS=Homo sapiens OX=9606 GN=CEP170 PE=1 SV=1
4	Q5SW79	0.0	3245	1584	1.000	1.000	CE170_HUMAN Centrosomal protein of 170 kDa OS=Homo sapiens OX=9606 GN=CEP170 PE=1 SV=1
5	Q6A065	0.0	2740	1588	0.891	0.889	CE170_MOUSE Centrosomal protein of 170 kDa OS=Mus musculus OX=10090 GN=Cep170 PE=1 SV=2
6	Q96L14	0.0	591	293	0.182	0.986	C170L_HUMAN Cep170-like protein OS=Homo sapiens OX=9606 GN=CEP170P1 PE=5 SV=2
7	H0Y4T4	2.61e-155	474	263	0.166	1.000	H0Y4T4_HUMAN Centrosomal protein 170 (Fragment) OS=Homo sapiens OX=9606 GN=CEP170 PE=1 SV=1
8	E5RG47	2.73e-112	354	175	0.110	1.000	E5RG47_HUMAN Centrosomal protein 170 (Fragment) OS=Homo sapiens OX=9606 GN=CEP170 PE=1 SV=1
9	Q9Y4F5	1.42e-100	358	1589	0.123	0.123	C170B_HUMAN Centrosomal protein of 170 kDa protein B OS=Homo sapiens OX=9606 GN=CEP170B PE=1 SV=4
10	E9PX68	1.91e-08	61.6	744	0.025	0.054	E9PX68_MOUSE Solute carrier family 4 (anion exchanger), member 1, adaptor protein OS=Mus musculus OX=10090 GN=Slc4a1ap PE=1 SV=1
11	E9Q585	1.97e-08	61.6	715	0.025	0.056	E9Q585_MOUSE Solute carrier family 4 (anion exchanger), member 1, adaptor protein OS=Mus musculus OX=10090 GN=Slc4a1ap PE=1 SV=1
12	Q6GQW1	2.08e-08	61.2	537	0.025	0.074	Q6GQW1_MOUSE Slc4a1ap protein (Fragment) OS=Mus musculus OX=10090 GN=Slc4a1ap PE=2 SV=1
13	Q3UUI2	2.15e-08	61.2	536	0.025	0.075	Q3UUI2_MOUSE FHA domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Slc4a1ap PE=2 SV=1
14	E9Q1Q0	2.16e-08	61.2	534	0.025	0.075	E9Q1Q0_MOUSE Solute carrier family 4 (anion exchanger), member 1, adaptor protein OS=Mus musculus OX=10090 GN=Slc4a1ap PE=1 SV=1
15	Q9BWU0	5.43e-08	60.1	796	0.024	0.048	NADAP_HUMAN Kanadaptin OS=Homo sapiens OX=9606 GN=SLC4A1AP PE=1 SV=1
16	A0A087X0M4	6.29e-08	60.1	742	0.024	0.051	A0A087X0M4_HUMAN Solute carrier family 4 member 1 adaptor protein OS=Homo sapiens OX=9606 GN=SLC4A1AP PE=1 SV=1
17	B1AK66	5.63e-06	53.1	396	0.019	0.076	B1AK66_HUMAN Smad nuclear interacting protein 1 OS=Homo sapiens OX=9606 GN=SNIP1 PE=2 SV=1
18	Q8TAD8	5.63e-06	53.1	396	0.019	0.076	SNIP1_HUMAN Smad nuclear-interacting protein 1 OS=Homo sapiens OX=9606 GN=SNIP1 PE=1 SV=1
19	Q8BIZ6	7.74e-06	52.4	383	0.019	0.078	SNIP1_MOUSE Smad nuclear-interacting protein 1 OS=Mus musculus OX=10090 GN=Snip1 PE=1 SV=1
20	Q4V8W8	4.87e-05	50.1	374	0.016	0.070	Q4V8W8_DANRE Smad nuclear-interacting protein OS=Danio rerio OX=7955 GN=snip1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15308 CEP170_C	2.3e-266	897.5	CEP170 C-terminus
2	PF14063 DUF4254	1.1e+02	14.1	Protein of unknown function (DUF4254)
3	PF00498 FHA	6.3e-12	57.0	FHA domain
4	PF16697 Yop-YscD_cpl	8.3e-05	34.1	Inner membrane component of T3SS, cytoplasmic domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355500

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000371472	0.976	Ninein
2	9606.ENSP00000466690	0.964	Coiled-coil domain-containing protein 68
3	9606.ENSP00000474071	0.953	Coiled-coil domain-containing protein 120
4	9606.ENSP00000384792	0.934	WD repeat-containing protein 62
5	9606.ENSP00000362962	0.931	Centriolin
6	9606.ENSP00000451162	0.925	Centrosomal protein 128
7	9606.ENSP00000368976	0.903	Kinesin-like protein KIFC3
8	9606.ENSP00000403453	0.898	Outer dense fiber protein 2
9	9606.ENSP00000385000	0.894	Kinesin-like protein KIF2A
10	9606.ENSP00000354791	0.813	Dynactin subunit 1
11	9606.ENSP00000361298	0.794	Kinesin-like protein KIF2C
12	9606.ENSP00000268919	0.767	Kinesin-like protein KIF2B
13	9606.ENSP00000370021	0.764	Centlein
14	9606.ENSP00000351539	0.754	Zinc finger and BTB domain-containing protein 18
15	9606.ENSP00000300093	0.748	Serine/threonine-protein kinase PLK1
16	9606.ENSP00000343818	0.732	CDK5 regulatory subunit-associated protein 2
17	9606.ENSP00000340132	0.729	Zinc finger protein 383
18	9606.ENSP00000370337	0.728	Centrosomal protein of 152 kDa
19	9606.ENSP00000278935	0.707	Centrosomal protein of 164 kDa
20	9606.ENSP00000371308	0.703	Centromere protein J

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.991	biological regulation
GO:0009987	0.975	cellular process
GO:0050789	0.955	regulation of biological process
GO:0050794	0.951	regulation of cellular process
GO:0071840	0.874	cellular component organization or biogenesis
GO:0016043	0.843	cellular component organization
GO:0006996	0.663	organelle organization
GO:0051179	0.506	localization
GO:0051641	0.424	cellular localization
GO:0048518	0.384	positive regulation of biological process
GO:0048522	0.338	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005813	1.000	centrosome
GO:0005814	0.993	centriole
GO:0043227	0.985	membrane-bounded organelle
GO:0032991	0.974	protein-containing complex
GO:0043231	0.806	intracellular membrane-bounded organelle
GO:0042995	0.801	cell projection
GO:0120025	0.793	plasma membrane bounded cell projection
GO:0005929	0.729	cilium
GO:0140535	0.727	intracellular protein-containing complex
GO:0120103	0.373	centriolar subdistal appendage
GO:0005634	0.324	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]