StarFunc result for job id Q5SWA1

User Input

>input (713 residues)
MEPGTGGSRKRLGPRAGFRFWPPFFPRRSQAGSSKFPTPLGPENSGNPTLLSSAQPETRV
SYWTKLLSQLLAPLPGLLQKVLIWSQLFGGMFPTRWLDFAGVYSALRALKGREKPAAPTA
QKSLSSLQLDSSDPSVTSPLDWLEEGIHWQYSPPDLKLELKAKGSALDPAAQAFLLEQQL
WGVELLPSSLQSRLYSNRELGSSPSGPLNIQRIDNFSVVSYLLNPSYLDCFPRLEVSYQN
SDGNSEVVGFQTLTPESSCLREDHCHPQPLSAELIPASWQGCPPLSTEGLPEIHHLRMKR
LEFLQQANKGQDLPTPDQDNGYHSLEEEHSLLRMDPKHCRDNPTQFVPAAGDIPGNTQES
TEEKIELLTTEVPLALEEESPSEGCPSSEIPMEKEPGEGRISVVDYSYLEGDLPISARPA
CSNKLIDYILGGASSDLETSSDPEGEDWDEEAEDDGFDSDSSLSDSDLEQDPEGLHLWNS
FCSVDPYNPQNFTATIQTAARIVPEEPSDSEKDLSGKSDLENSSQSGSLPETPEHSSGEE
DDWESSADEAESLKLWNSFCNSDDPYNPLNFKAPFQTSGENEKGCRDSKTPSESIVAISE
CHTLLSCKVQLLGSQESECPDSVQRDVLSGGRHTHVKRKKVTFLEEVTEYYISGDEDRKG
PWEEFARDGCRFQKRIQETEDAIGYCLTFEHRERMFNRLQGTCFKGLNVLKQC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5SWA1	1.000	1.000	4.262E-103	713	1.000	1.000	Q5SWA1.pdb.gz	PR15B_HUMAN Protein phosphatase 1 regulatory subunit 15B OS=Homo sapiens OX=9606 GN=PPP1R15B PE=1 SV=2
2	AFDB:Q8BFW3	0.278	0.283	4.161E-66	697	0.677	0.693	Q8BFW3.pdb.gz	PR15B_MOUSE Protein phosphatase 1 regulatory subunit 15B OS=Mus musculus OX=10090 GN=Ppp1r15b PE=1 SV=1
3	AFDB:A0A1D5NSI1	0.053	0.027	2.568E-2	1996	0.153	0.055	A0A1D5NSI1.pdb.gz
4	AFDB:Q8IQN4	0.076	0.052	4.012E-2	1144	0.142	0.088	Q8IQN4.pdb.gz	Q8IQN4_DROME FI18194p1 OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=2
5	AFDB:M9PCQ3	0.063	0.042	1.436E-1	1111	0.143	0.092	M9PCQ3.pdb.gz	M9PCQ3_DROME Myosin binding subunit, isoform Q OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
6	AFDB:O95835	0.055	0.040	1.436E-1	1130	0.146	0.092	O95835.pdb.gz	LATS1_HUMAN Serine/threonine-protein kinase LATS1 OS=Homo sapiens OX=9606 GN=LATS1 PE=1 SV=1
7	AFDB:P56975	0.079	0.079	1.631E-1	720	0.142	0.140	P56975.pdb.gz	NRG3_HUMAN Pro-neuregulin-3, membrane-bound isoform OS=Homo sapiens OX=9606 GN=NRG3 PE=1 SV=1
8	AFDB:Q86P90	0.057	0.060	1.853E-1	661	0.147	0.159	Q86P90.pdb.gz	Q86P90_DROME GH08772p OS=Drosophila melanogaster OX=7227 GN=LUBEL PE=2 SV=1
9	AFDB:Q09994	0.061	0.046	1.975E-1	1009	0.132	0.093	Q09994.pdb.gz	ANI2_CAEEL Anillin-like protein 2 OS=Caenorhabditis elegans OX=6239 GN=ani-2 PE=2 SV=1
10	AFDB:P53858	0.060	0.050	2.895E-1	892	0.136	0.109	P53858.pdb.gz	BNI4_YEAST Protein BNI4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BNI4 PE=1 SV=1
11	PDB:6ucjA	0.059	0.268	7.798	67	0.010	0.104	6ucjA.pdb.gz
12	PDB:7d5sRN	0.071	0.081	8.311	607	0.020	0.023	7d5sRN.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
13	PDB:8gxqs	0.051	0.198	8.311	93	0.022	0.172	8gxqs.pdb.gz	Structures of +1 nucleosome-bound PIC-Mediator complex.
14	PDB:7mqaNS	0.046	0.037	8.858	914	0.024	0.019	7mqaNS.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5SWA1	0.0	1453	713	1.000	1.000	PR15B_HUMAN Protein phosphatase 1 regulatory subunit 15B OS=Homo sapiens OX=9606 GN=PPP1R15B PE=1 SV=2
2	Q8BFW3	0.0	872	697	0.676	0.692	PR15B_MOUSE Protein phosphatase 1 regulatory subunit 15B OS=Mus musculus OX=10090 GN=Ppp1r15b PE=1 SV=1
3	P17564	2.42e-08	59.7	657	0.039	0.043	PR15A_MOUSE Protein phosphatase 1 regulatory subunit 15A OS=Mus musculus OX=10090 GN=Ppp1r15a PE=1 SV=1
4	Q6IN02	5.44e-08	58.5	578	0.039	0.048	PR15A_RAT Protein phosphatase 1 regulatory subunit 15A OS=Rattus norvegicus OX=10116 GN=Ppp1r15a PE=2 SV=2
5	O75807	1.24e-05	51.2	674	0.032	0.034	PR15A_HUMAN Protein phosphatase 1 regulatory subunit 15A OS=Homo sapiens OX=9606 GN=PPP1R15A PE=1 SV=1
6	Q9NW81	0.078	38.1	257	0.031	0.086	DMAC2_HUMAN Distal membrane-arm assembly complex protein 2 OS=Homo sapiens OX=9606 GN=DMAC2 PE=1 SV=3
7	Q9W1E4	0.22	37.0	317	0.036	0.082	Q9W1E4_DROME GH11727p OS=Drosophila melanogaster OX=7227 GN=PPP1R15 PE=2 SV=1
8	E5KN95	6.2	32.3	518	0.045	0.062	E5KN95_HUMAN DNA-(apurinic or apyrimidinic site) endonuclease OS=Homo sapiens OX=9606 GN=APEX2 PE=3 SV=1
9	Q9UBZ4	6.2	32.3	518	0.045	0.062	APEX2_HUMAN DNA-(apurinic or apyrimidinic site) endonuclease 2 OS=Homo sapiens OX=9606 GN=APEX2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10472 CReP_N	5.8e-231	778.1	eIF2-alpha phosphatase phosphorylation constitutive repressor
2	PF10488 PP1c_bdg	3.5e-161	547.0	Phosphatase-1 catalytic subunit binding region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356156

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000341779	0.999	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
2	9606.ENSP00000326031	0.975	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
3	9606.ENSP00000478767	0.933	Neurabin-2
4	9606.ENSP00000307786	0.932	Cytochrome c
5	9606.ENSP00000389168	0.927	Protein phosphatase 1 regulatory subunit 12A
6	9606.ENSP00000378769	0.925	Serine/threonine-protein phosphatase PP1-beta catalytic subunit
7	9606.ENSP00000324804	0.907	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
8	9606.ENSP00000234310	0.902	Calcineurin subunit B type 1
9	9606.ENSP00000261461	0.902	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform
10	9606.ENSP00000325074	0.902	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform
11	9606.ENSP00000461749	0.902	CTD nuclear envelope phosphatase 1
12	9606.ENSP00000305924	0.901	Serine/threonine-protein phosphatase 4 regulatory subunit 4
13	9606.ENSP00000221138	0.900	Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
14	9606.ENSP00000296490	0.900	WD repeat-containing protein 82
15	9606.ENSP00000349124	0.900	Serine/threonine-protein phosphatase 4 regulatory subunit 2
16	9606.ENSP00000358464	0.900	Leucine-rich repeat protein SHOC-2
17	9606.ENSP00000378306	0.900	Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform
18	9606.ENSP00000378323	0.900	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform
19	9606.ENSP00000405635	0.900	CTD nuclear envelope phosphatase 1 regulatory subunit 1
20	9606.ENSP00000412324	0.900	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0023051	0.971	regulation of signaling
GO:0048583	0.964	regulation of response to stimulus
GO:0010646	0.960	regulation of cell communication
GO:0019222	0.956	regulation of metabolic process
GO:0009966	0.952	regulation of signal transduction
GO:0060255	0.937	regulation of macromolecule metabolic process
GO:0080090	0.934	regulation of primary metabolic process
GO:0009987	0.921	cellular process
GO:0031323	0.917	regulation of cellular metabolic process
GO:0051171	0.913	regulation of nitrogen compound metabolic process
GO:0048523	0.903	negative regulation of cellular process
GO:0080134	0.893	regulation of response to stress
GO:0008152	0.892	metabolic process
GO:0019220	0.874	regulation of phosphate metabolic process
GO:0071704	0.869	organic substance metabolic process
GO:0044238	0.860	primary metabolic process
GO:0010605	0.860	negative regulation of macromolecule metabolic process
GO:0023057	0.854	negative regulation of signaling
GO:0010648	0.854	negative regulation of cell communication
GO:0031399	0.854	regulation of protein modification process
GO:0048585	0.845	negative regulation of response to stimulus
GO:0031324	0.837	negative regulation of cellular metabolic process
GO:1905897	0.836	regulation of response to endoplasmic reticulum stress
GO:0051172	0.832	negative regulation of nitrogen compound metabolic process
GO:0009968	0.828	negative regulation of signal transduction
GO:0045936	0.810	negative regulation of phosphate metabolic process
GO:0031400	0.799	negative regulation of protein modification process
GO:0044237	0.760	cellular metabolic process
GO:0001933	0.752	negative regulation of protein phosphorylation
GO:0006807	0.748	nitrogen compound metabolic process
GO:0050896	0.731	response to stimulus
GO:0043170	0.634	macromolecule metabolic process
GO:1900101	0.592	regulation of endoplasmic reticulum unfolded protein response
GO:1901564	0.555	organonitrogen compound metabolic process
GO:0019538	0.535	protein metabolic process
GO:0043412	0.495	macromolecule modification
GO:0010468	0.464	regulation of gene expression
GO:0051716	0.448	cellular response to stimulus
GO:0007154	0.444	cell communication
GO:0031326	0.439	regulation of cellular biosynthetic process
GO:0036211	0.419	protein modification process
GO:1903573	0.349	negative regulation of response to endoplasmic reticulum stress
GO:0006470	0.335	protein dephosphorylation
GO:0010556	0.313	regulation of macromolecule biosynthetic process
GO:0023052	0.308	signaling
GO:0048518	0.301	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000164	0.997	protein phosphatase type 1 complex
GO:0005829	0.478	cytosol
GO:0005634	0.462	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]