StarFunc result for job id Q5SXM2

User Input

>input (1469 residues)
MDVDAEREKITQEIKELERILDPGSSGSHVEISESSLESDSEADSLPSEDLDPADPPISE
EERWGEASNDEDDPKDKTLPEDPETCLQLNMVYQEVIQEKLAEANLLLAQNREQQEELMR
DLAGSKGTKVKDGKSLPPSTYMGHFMKPYFKDKVTGVGPPANEDTREKAAQGIKAFEELL
VTKWKNWEKALLRKSVVSDRLQRLLQPKLLKLEYLHQKQSKVSSELERQALEKQGREAEK
EIQDINQLPEEALLGNRLDSHDWEKISNINFEGSRSAEEIRKFWQNSEHPSINKQEWSRE
EEERLQAIAAAHGHLEWQKIAEELGTSRSAFQCLQKFQQHNKALKRKEWTEEEDRMLTQL
VQEMRVGSHIPYRRIVYYMEGRDSMQLIYRWTKSLDPGLKKGYWAPEEDAKLLQAVAKYG
EQDWFKIREEVPGRSDAQCRDRYLRRLHFSLKKGRWNLKEEEQLIELIEKYGVGHWAKIA
SELPHRSGSQCLSKWKIMMGKKQGLRRRRRRARHSVRWSSTSSSGSSSGSSGGSSSSSSS
SSEEDEPEQAQAGEGDRALLSPQYMVPDMDLWVPARQSTSQPWRGGAGAWLGGPAASLSP
PKGSSASQGGSKEASTTAAAPGEETSPVQVPARAHGPVPRSAQASHSADTRPAGAEKQAL
EGGRRLLTVPVETVLRVLRANTAARSCTQKEQLRQPPLPTSSPGVSSGDSVARSHVQWLR
HRATQSGQRRWRHALHRRLLNRRLLLAVTPWVGDVVVPCTQASQRPAVVQTQADGLREQL
QQARLASTPVFTLFTQLFHIDTAGCLEVVRERKALPPRLPQAGARDPPVHLLQASSSAQS
TPGHLFPNVPAQEASKSASHKGSRRLASSRVERTLPQASLLASTGPRPKPKTVSELLQEK
RLQEARAREATRGPVVLPSQLLVSSSVILQPPLPHTPHGRPAPGPTVLNVPLSGPGAPAA
AKPGTSGSWQEAGTSAKDKRLSTMQALPLAPVFSEAEGTAPAASQAPALGPGQISVSCPE
SGLGQSQAPAASRKQGLPEAPPFLPAAPSPTPLPVQPLSLTHIGGPHVATSVPLPVTWVL
TAQGLLPVPVPAVVSLPRPAGTPGPAGLLATLLPPLTETRAAQGPRAPALSSSWQPPANM
NREPEPSCRTDTPAPPTHALSQSPAEADGSVAFVPGEAQVAREIPEPRTSSHADPPEAEP
PWSGRLPAFGGVIPATEPRGTPGSPSGTQEPRGPLGLEKLPLRQPGPEKGALDLEKPPLP
QPGPEKGALDLGLLSQEGEAATQQWLGGQRGVRVPLLGSRLPYQPPALCSLRALSGLLLH
KKALEHKATSLVVGGEAERPAGALQASLGLVRGQLQDNPAYLLLRARFLAAFTLPALLAT
LAPQGVRTTLSVPSRVGSESEDEDLLSELELADRDGQPGCTTATCPIQGAPDSGKCSASS
CLDTSNDPDDLDVLRTRHARHTRKRRRLV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5SXM2	0.999	0.999	0.000	1469	1.000	1.000	Q5SXM2.pdb.gz	SNPC4_HUMAN snRNA-activating protein complex subunit 4 OS=Homo sapiens OX=9606 GN=SNAPC4 PE=1 SV=1
2	AFDB:F1QVS5	0.253	0.241	1.028E-46	1561	0.297	0.280	F1QVS5.pdb.gz	F1QVS5_DANRE Small nuclear RNA-activating complex, polypeptide 4 OS=Danio rerio OX=7955 GN=fi18h02 PE=4 SV=3
3	AFDB:P34127	0.104	0.122	5.047E-11	1230	0.095	0.114	P34127.pdb.gz	MYBA_DICDI Myb-like protein A OS=Dictyostelium discoideum OX=44689 GN=mybA PE=4 SV=2
4	AFDB:E7FF48	0.043	0.031	1.831E-5	2315	0.172	0.109	E7FF48.pdb.gz	E7FF48_DANRE Nuclear receptor corepressor 2 OS=Danio rerio OX=7955 GN=SMRT PE=1 SV=2
5	AFDB:Q60974	0.048	0.033	9.393E-5	2453	0.159	0.095	Q60974.pdb.gz	NCOR1_MOUSE Nuclear receptor corepressor 1 OS=Mus musculus OX=10090 GN=Ncor1 PE=1 SV=1
6	AFDB:Q55GF9	0.033	0.037	1.570E-4	1320	0.118	0.131	Q55GF9.pdb.gz	ICPA_DICDI Inner centromere protein A OS=Dictyostelium discoideum OX=44689 GN=icpA PE=1 SV=1
7	AFDB:S8GIB3	0.081	0.051	1.724E-4	2415	0.105	0.064	S8GIB3.pdb.gz	BFD1_TOXGM Bradyzoite-formation deficient protein 1 OS=Toxoplasma gondii (strain ATCC 50611 / Me49) OX=508771 GN=BFD1 PE=2 SV=2
8	AFDB:Q9VU76	0.042	0.039	2.391E-4	1657	0.148	0.132	Q9VU76.pdb.gz	Q9VU76_DROME Combover, isoform A OS=Drosophila melanogaster OX=7227 GN=cmb PE=1 SV=2
9	PDB:6qdvO	0.069	0.222	3.910E-4	441	0.024	0.079	6qdvO.pdb.gz	A human postcatalytic spliceosome structure reveals essential roles of metazoan factors for exon ligation.
10	PDB:5z56L	0.068	0.279	6.239E-4	342	0.025	0.108	5z56L.pdb.gz	Structure of the human activated spliceosome in three conformational states.
11	AFDB:A0A2R8Q4C2	0.038	0.027	7.338E-4	2404	0.148	0.090	A0A2R8Q4C2.pdb.gz
12	AFDB:D3ZXN9	0.043	0.031	1.066E-3	2472	0.166	0.099	D3ZXN9.pdb.gz	D3ZXN9_RAT Nuclear receptor co-repressor 2 OS=Rattus norvegicus OX=10116 GN=Ncor2 PE=1 SV=2
13	PDB:5yzgL	0.068	0.232	1.664E-3	419	0.024	0.084	5yzgL.pdb.gz	Structure of a human catalytic step I spliceosome
14	PDB:6id0L	0.069	0.207	2.655E-3	475	0.024	0.074	6id0L.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
15	PDB:6iczL	0.069	0.216	3.201E-3	454	0.024	0.077	6iczL.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
16	PDB:3jb9W	0.060	0.191	4.236E-3	426	0.027	0.092	3jb9W.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
17	PDB:5gm6c	0.067	0.228	7.421E-3	415	0.020	0.070	5gm6c.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
18	PDB:6j6gc	0.062	0.195	1.078E-2	436	0.029	0.096	6j6gc.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
19	PDB:5mqfL	0.066	0.274	1.362E-2	336	0.022	0.098	5mqfL.pdb.gz	Cryo-EM structure of a human spliceosome activated for step 2 of splicing.
20	PDB:7dcoL	0.059	0.188	1.642E-2	435	0.024	0.080	7dcoL.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5SXM2	0.0	2934	1469	1.000	1.000	SNPC4_HUMAN snRNA-activating protein complex subunit 4 OS=Homo sapiens OX=9606 GN=SNAPC4 PE=1 SV=1
2	F1QVS5	2.81e-142	477	1561	0.178	0.167	F1QVS5_DANRE Small nuclear RNA-activating complex, polypeptide 4 OS=Danio rerio OX=7955 GN=fi18h02 PE=4 SV=3
3	I1V1W6	3.67e-142	477	1557	0.178	0.168	I1V1W6_DANRE SNAPC4 OS=Danio rerio OX=7955 GN=si:dkey-1o2.5 PE=2 SV=1
4	Q9LV31	6.64e-38	156	847	0.060	0.104	Q9LV31_ARATH Myb domain protein 4r1 OS=Arabidopsis thaliana OX=3702 GN=MYB4R1 PE=2 SV=1
5	Q9VHX0	5.41e-23	108	721	0.045	0.092	Q9VHX0_DROME LD18233p OS=Drosophila melanogaster OX=7227 GN=Pbp95 PE=2 SV=1
6	Q0JHU7	2.47e-21	102	587	0.037	0.094	MB3R2_ORYSJ Transcription factor MYB3R-2 OS=Oryza sativa subsp. japonica OX=39947 GN=MYB3R-2 PE=2 SV=1
7	Q94FL9	3.26e-21	103	961	0.037	0.057	MB3R4_ARATH Transcription factor MYB3R-4 OS=Arabidopsis thaliana OX=3702 GN=MYB3R4 PE=1 SV=1
8	Q8H1P9	4.62e-21	101	505	0.037	0.109	MB3R3_ARATH Transcription factor MYB3R-3 OS=Arabidopsis thaliana OX=3702 GN=MYB3R3 PE=1 SV=1
9	F4JV48	5.37e-21	102	995	0.045	0.066	F4JV48_ARATH Homeodomain-like protein OS=Arabidopsis thaliana OX=3702 GN=PC-MYB1 PE=1 SV=1
10	Q9S7G7	6.13e-21	102	776	0.036	0.068	MB3R1_ARATH Transcription factor MYB3R-1 OS=Arabidopsis thaliana OX=3702 GN=MYB3R1 PE=2 SV=1
11	Q6R032	6.55e-21	100	548	0.037	0.100	MB3R5_ARATH Transcription factor MYB3R-5 OS=Arabidopsis thaliana OX=3702 GN=MYB3R5 PE=2 SV=1
12	P06876	1.27e-20	100	636	0.037	0.086	MYB_MOUSE Transcriptional activator Myb OS=Mus musculus OX=10090 GN=Myb PE=1 SV=2
13	A0A087WTI6	1.63e-20	100	660	0.037	0.083	A0A087WTI6_HUMAN MYB proto-oncogene, transcription factor OS=Homo sapiens OX=9606 GN=MYB PE=1 SV=1
14	F1QP24	1.68e-20	100	641	0.038	0.087	F1QP24_DANRE Transcriptional activator Myb isoform 1 OS=Danio rerio OX=7955 GN=c-myb PE=4 SV=1
15	F8W8G5	1.76e-20	100	726	0.037	0.076	F8W8G5_HUMAN MYB proto-oncogene, transcription factor OS=Homo sapiens OX=9606 GN=MYB PE=1 SV=1
16	E9PLN0	1.85e-20	100	611	0.037	0.090	E9PLN0_HUMAN MYB proto-oncogene, transcription factor OS=Homo sapiens OX=9606 GN=MYB PE=1 SV=1
17	A0A0G2K2A4	2.04e-20	100	747	0.037	0.072	A0A0G2K2A4_RAT MYB proto-oncogene, transcription factor OS=Rattus norvegicus OX=10116 GN=Myb PE=1 SV=2
18	Q708E1	2.13e-20	99.8	612	0.037	0.090	Q708E1_HUMAN C-myb v-myb myeloblastosis viral oncogene homologue (avian), exon 1 and joined CDS OS=Homo sapiens OX=9606 GN=c-myb PE=1 SV=1
19	P10242	2.16e-20	99.8	640	0.037	0.086	MYB_HUMAN Transcriptional activator Myb OS=Homo sapiens OX=9606 GN=MYB PE=1 SV=2
20	Q708E9	2.16e-20	99.8	640	0.037	0.086	Q708E9_HUMAN C-myb v-myb myeloblastosis viral oncogene homologue (avian), exon 1 and joined CDS OS=Homo sapiens OX=9606 GN=MYB PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13384 HTH_23	1.3e+02	13.9	Homeodomain-like domain
2	PF00249 Myb_DNA-binding	3.9e-43	156.7	Myb-like DNA-binding domain
3	PF13921 Myb_DNA-bind_6	2.2e-30	116.0	Myb-like DNA-binding domain
4	PF16282 SANT_DAMP1_like	9.7e+02	11.4	SANT/Myb-like domain of DAMP1
5	PF09111 SLIDE	0.00094	30.6	SLIDE

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000298532

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216294	0.999	snRNA-activating protein complex subunit 1
2	9606.ENSP00000370200	0.999	snRNA-activating protein complex subunit 3
3	9606.ENSP00000221573	0.995	snRNA-activating protein complex subunit 2
4	9606.ENSP00000319597	0.987	snRNA-activating protein complex subunit 5
5	9606.ENSP00000356840	0.950	POU domain, class 2, transcription factor 1
6	9606.ENSP00000375942	0.884	TATA-box-binding protein
7	9606.ENSP00000351575	0.850	Transcription factor TFIIIB component B'' homolog
8	9606.ENSP00000347345	0.837	DNA-directed RNA polymerase III subunit RPC8
9	9606.ENSP00000364691	0.828	Rootletin
10	9606.ENSP00000299853	0.783	DNA-directed RNA polymerase III subunit RPC5
11	9606.ENSP00000366828	0.767	DNA-directed RNA polymerase III subunit RPC6
12	9606.ENSP00000380904	0.763	DNA-directed RNA polymerase III subunit RPC4
13	9606.ENSP00000448073	0.735	Pre-mRNA-processing factor 40 homolog B
14	9606.ENSP00000382058	0.731	DNA-directed RNA polymerase III subunit RPC7
15	9606.ENSP00000361465	0.723	DNA-directed RNA polymerases I and III subunit RPAC1
16	9606.ENSP00000298545	0.720	Adenylate kinase 8
17	9606.ENSP00000482438	0.704	Mediator of RNA polymerase II transcription subunit 22
18	9606.ENSP00000334564	0.697	DNA-directed RNA polymerase III subunit RPC3
19	9606.ENSP00000360821	0.694	Ubiquitin-associated domain-containing protein 1
20	9606.ENSP00000361092	0.694	Surfeit locus protein 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016251	1.000	RNA polymerase II general transcription initiation factor activity
GO:0000995	1.000	RNA polymerase III general transcription initiation factor activity
GO:0003677	1.000	DNA binding
GO:0005515	0.932	protein binding
GO:0043565	0.835	sequence-specific DNA binding
GO:0003690	0.784	double-stranded DNA binding
GO:1990837	0.739	sequence-specific double-stranded DNA binding
GO:0000976	0.697	transcription cis-regulatory region binding
GO:0140110	0.479	transcription regulator activity
GO:0003700	0.356	DNA-binding transcription factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0006351	0.985	DNA-templated transcription
GO:0006366	0.951	transcription by RNA polymerase II
GO:0016073	0.916	snRNA metabolic process
GO:0006383	0.816	transcription by RNA polymerase III
GO:0098781	0.686	ncRNA transcription
GO:0050789	0.440	regulation of biological process
GO:0050794	0.368	regulation of cellular process
GO:0060255	0.320	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005654	1.000	nucleoplasm
GO:0005667	0.991	transcription regulator complex
GO:0140513	0.844	nuclear protein-containing complex
GO:0019185	0.697	snRNA-activating protein complex
GO:0005737	0.550	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]