StarFunc result for job id Q5SYB0

User Input

>input (1578 residues)
MEELETSLFQTRKAHRIEQMVARWLRRSRDSSARAKVAAADGPARNPTQTLIPVRHTVKI
DKDTLLQDYGFHISESLPLTVVAVTAGGSAHGKLFPGDQILQMNNEPAEDLSWERAVDIL
REAEDSLSITVVRCTSGVPKSSFLTEEKRARLKTNPVKVHFAEEVLISGHSQGNSLLCMP
NVLKLYLENGQTKAFKFEANTTVKDIILTVKEKLSIRSIEYFALALEEQYSISRLHLLHE
EELIQQVVEREESHDYRCLFRVCFVPKDPLDLLKEDPVAFEYLYLQSCSDVLQERFAVEM
KCSSALRLAALHIQERIYACAQPQKISLKYIEKDWGIENFISPTLLRNMKGKDIKKAISF
HMKRNQNLLEPRQKQLISAAQLRLNYLQILGELKTYGGRIFNATLMLQDRESYIALLVGA
KYGISQVINSKLNIMSTLAEFANISRVELTEESEKVSVVKVYLQDVKVLTLLLESNSAKD
LACLIAGYYRLLVDPVTSIFLWPGNKQQAHRVSAEEGYESRACSDSEESSEVDCVLEPLS
DRRLVKLAPCRSLIKEEQPPGNSPTPEVARRGPSTCGASSTTDSAESEASDSANTESRGY
RTSGSSESMDALEEDDLDTCSSSRSTFFHFGSPGLAESIDSDSQEERSGIETSGFLCLLD
LAQRANPQCQKTEFSESAALETFGWAPELSTVRLDPRLYEGSHADYYSLCSSVSPASYLS
DSSESTASRQGGAPPAWGQQGWTEAQPSSMLEPLALHPPLAFEDGSSDEEYYDAADKLTP
PGPPSGPRDVSTAEPSATSLQNKASTSSPENSLPCGPDGRQPSRRGGVKKYAKTLRKRRS
FLQTDYTSQVSFPLVPSASLESVDDVCYYDREPYLALGAPSPTVSSLQDMQGEPGLLETK
ALGLLAPLRETKSTNPASRVMEMEPETMETKSVIDSRVSSISAIRFRIDPNNKENSGVVP
AASSSASTPHCSNPGSSGPDTAQARPSQILPLSQDLDGIAPKEPTIEHGDSSFSLSSGDP
NPDRACLASNPGLNNVSQGDTLELQLEPHVQLEMGLESFCTNHIQETAPKYTEPLLSPRD
EPRSDECGINPGEKIASIPTKEEPQGQLSLERDREVTNKNGTNVFQEESRKDSGDSPGDV
SNNVSQTLDISSPAGKIVTSLSLDAPVTGTEQIPPHPPRDPQGQSREPPGQGCQAQEQKL
FVELDLDPDFFLGKQTVSPAVPPEGIKAEAPNHVTGQDIAPRDSPEWVCFNPEPSLPEPL
PCPQEDPHLETSNHCLLSEGKSDSSSICLSAEKSFLCFAPESHPEVSASLRVATSLGFAG
MNEMVAPRIGMDQCSCQFSYATCFRGPQPETEEEDRDLEAHPMAPLTSPPSAGSPVVLPW
RPARAHSCTTAPLSRKSHIWPEYCSRALRQLKATPASTPEGFIQLMESLLELQDILETSW
GVGNKHPPEKCTWHFTESRSRLCMGSQKLLSSCRHVIRMDQSPEEMQGAVRDTFQHLVQL
AGLCFQFTDCSRCSARHREAAGNLRDVVYTYHQFIEAAKSTCERGYHDLSVKLLARQCTA
LTAAVFCLTQKFRASTAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZW88	0.401	0.453	0.000	1371	0.650	0.748	D3ZW88.pdb.gz	D3ZW88_RAT FERM and PDZ domain containing 1 OS=Rattus norvegicus OX=10116 GN=Frmpd1 PE=4 SV=3
2	AFDB:Q5SYB0	1.000	1.000	0.000	1578	1.000	1.000	Q5SYB0.pdb.gz	FRPD1_HUMAN FERM and PDZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FRMPD1 PE=1 SV=1
3	AFDB:D4A3K7	0.254	0.238	1.565E-57	1705	0.279	0.259	D4A3K7.pdb.gz	D4A3K7_RAT FERM and PDZ domain containing 4 OS=Rattus norvegicus OX=10116 GN=Frmpd4 PE=4 SV=2
4	AFDB:Q5JV73	0.212	0.186	1.740E-48	1810	0.244	0.213	Q5JV73.pdb.gz	FRPD3_HUMAN FERM and PDZ domain-containing protein 3 OS=Homo sapiens OX=9606 GN=FRMPD3 PE=2 SV=2
5	AFDB:A0A286YBL8	0.164	0.210	5.527E-13	1204	0.093	0.122	A0A286YBL8.pdb.gz	A0A286YBL8_DANRE protein-tyrosine-phosphatase OS=Danio rerio OX=7955 GN=ptpn21 PE=3 SV=1
6	AFDB:F1Q6T9	0.166	0.219	8.830E-12	1168	0.093	0.126	F1Q6T9.pdb.gz	F1Q6T9_DANRE Tyrosine-protein phosphatase non-receptor type OS=Danio rerio OX=7955 GN=ptpn21 PE=3 SV=2
7	AFDB:Q62728	0.167	0.221	2.439E-11	1175	0.088	0.118	Q62728.pdb.gz	PTN21_RAT Tyrosine-protein phosphatase non-receptor type 21 OS=Rattus norvegicus OX=10116 GN=Ptpn21 PE=1 SV=1
8	PDB:4rm8A	0.153	0.581	1.981E-10	368	0.031	0.133	4rm8A.pdb.gz
9	AFDB:Q07436	0.152	0.167	6.563E-8	1427	0.133	0.147	Q07436.pdb.gz	EXPA_DROME Protein expanded OS=Drosophila melanogaster OX=7227 GN=ex PE=1 SV=3
10	PDB:7c3mA	0.145	0.365	1.024E-5	577	0.039	0.107	7c3mA.pdb.gz
11	PDB:7qqmA	0.055	0.202	1.794E-4	413	0.042	0.162	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
12	PDB:7pc3A	0.057	0.202	2.261E-4	405	0.043	0.168	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
13	AFDB:O70608	0.074	0.077	2.440E-4	1505	0.123	0.129	O70608.pdb.gz	SYCP2_RAT Synaptonemal complex protein 2 OS=Rattus norvegicus OX=10116 GN=Sycp2 PE=1 SV=1
14	AFDB:Q9CUU3	0.072	0.075	2.555E-4	1500	0.124	0.130	Q9CUU3.pdb.gz	SYCP2_MOUSE Synaptonemal complex protein 2 OS=Mus musculus OX=10090 GN=Sycp2 PE=1 SV=2
15	PDB:5n7dA	0.055	0.185	4.733E-4	423	0.034	0.128	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.
16	PDB:7p73A	0.065	0.199	4.733E-4	420	0.035	0.133	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
17	PDB:7p70A	0.059	0.211	9.462E-4	407	0.035	0.135	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
18	PDB:7qqnC	0.050	0.181	9.909E-4	414	0.039	0.147	7qqnC.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
19	PDB:6t36A	0.050	0.752	1.434E-3	93	0.013	0.215	6t36A.pdb.gz	Molecular basis of the interaction of the human tyrosine phosphatase PTPN3 with the hepatitis B virus core protein.
20	PDB:7pcbA	0.053	0.192	2.867E-3	415	0.032	0.120	7pcbA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZW88	0.0	2304	1549	0.755	0.770	D3ZW88_RAT FERM and PDZ domain containing 1 OS=Rattus norvegicus OX=10116 GN=Frmpd1 PE=4 SV=3
2	Q5SYB0	0.0	3245	1578	1.000	1.000	FRPD1_HUMAN FERM and PDZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FRMPD1 PE=1 SV=1
3	Q14CM0	1.77e-142	475	1322	0.151	0.180	FRPD4_HUMAN FERM and PDZ domain-containing protein 4 OS=Homo sapiens OX=9606 GN=FRMPD4 PE=1 SV=1
4	A0A8I6ALF4	4.83e-142	474	1317	0.151	0.181	A0A8I6ALF4_RAT FERM and PDZ domain containing 4 OS=Rattus norvegicus OX=10116 GN=Frmpd4 PE=4 SV=1
5	A0A8I6GKT4	1.40e-139	474	1705	0.151	0.140	A0A8I6GKT4_RAT FERM and PDZ domain containing 4 OS=Rattus norvegicus OX=10116 GN=Frmpd4 PE=4 SV=1
6	A0A8I6ALA6	3.29e-139	474	1759	0.151	0.135	A0A8I6ALA6_RAT FERM and PDZ domain containing 4 OS=Rattus norvegicus OX=10116 GN=Frmpd4 PE=4 SV=1
7	D4A3K7	5.39e-139	473	1777	0.151	0.134	D4A3K7_RAT FERM and PDZ domain containing 4 OS=Rattus norvegicus OX=10116 GN=Frmpd4 PE=4 SV=2
8	Q5JV73	3.98e-103	368	1810	0.122	0.107	FRPD3_HUMAN FERM and PDZ domain-containing protein 3 OS=Homo sapiens OX=9606 GN=FRMPD3 PE=2 SV=2
9	A0A2R8RR02	2.31e-14	81.3	1101	0.054	0.077	A0A2R8RR02_DANRE non-specific protein-tyrosine kinase OS=Danio rerio OX=7955 GN=fak PE=1 SV=1
10	Q98SN4	3.65e-14	80.5	1050	0.054	0.081	Q98SN4_DANRE non-specific protein-tyrosine kinase OS=Danio rerio OX=7955 GN=fak1a PE=1 SV=1
11	P34152	3.83e-11	70.9	1052	0.054	0.081	FAK1_MOUSE Focal adhesion kinase 1 OS=Mus musculus OX=10090 GN=Ptk2 PE=1 SV=4
12	Q14289	2.31e-08	61.6	1009	0.048	0.074	FAK2_HUMAN Protein-tyrosine kinase 2-beta OS=Homo sapiens OX=9606 GN=PTK2B PE=1 SV=2
13	Q9QVP9	3.30e-08	61.2	1009	0.046	0.071	FAK2_MOUSE Protein-tyrosine kinase 2-beta OS=Mus musculus OX=10090 GN=Ptk2b PE=1 SV=2
14	P70600	3.87e-08	60.8	1009	0.046	0.071	FAK2_RAT Protein-tyrosine kinase 2-beta OS=Rattus norvegicus OX=10116 GN=Ptk2b PE=1 SV=1
15	B7YZL9	1.07e-04	49.7	1500	0.053	0.056	B7YZL9_DROME Focal adhesion kinase, isoform D OS=Drosophila melanogaster OX=7227 GN=Fak PE=4 SV=1
16	Q5BIG9	3.67e-04	47.8	1200	0.022	0.029	Q5BIG9_DROME RE57482p OS=Drosophila melanogaster OX=7227 GN=Fak PE=2 SV=1
17	Q0E917	3.70e-04	47.8	1200	0.022	0.029	Q0E917_DROME FI18818p1 OS=Drosophila melanogaster OX=7227 GN=Fak PE=2 SV=1
18	Q9U472	3.76e-04	47.8	1200	0.022	0.029	Q9U472_DROME Focal adhesion kinase homolog FAK56 OS=Drosophila melanogaster OX=7227 GN=Fak PE=2 SV=1
19	Q9U531	3.82e-04	47.8	1200	0.022	0.029	Q9U531_DROME Focal adhesion kinase homolog DFak56 OS=Drosophila melanogaster OX=7227 GN=Fak PE=2 SV=1
20	E1JGM8	3.95e-04	47.8	1198	0.022	0.029	E1JGM8_DROME Focal adhesion kinase, isoform F OS=Drosophila melanogaster OX=7227 GN=Fak PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07270 DUF1438	29	16.2	Protein of unknown function (DUF1438)
2	PF16511 FERM_f0	9.3	18.0	N-terminal or F0 domain of Talin-head FERM
3	PF00373 FERM_M	1e-14	66.3	FERM central domain
4	PF09379 FERM_N	32	15.8	FERM N-terminal domain
5	PF17887 Jak1_Phl	1.7	20.0	Jak1 pleckstrin homology-like domain
6	PF00595 PDZ	0.00037	32.1	PDZ domain
7	PF17820 PDZ_6	2.5	19.4	PDZ domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000444411

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000403802	0.808	F-box only protein 10
2	9606.ENSP00000365533	0.733	Citramalyl-CoA lyase, mitochondrial
3	9606.ENSP00000366953	0.679	DDB1- and CUL4-associated factor 10
4	9606.ENSP00000376522	0.677	Centrosomal protein 112
5	9606.ENSP00000423505	0.652	Tetratricopeptide repeat domain containing
6	9606.ENSP00000325941	0.600	Synembryn-A
7	9606.ENSP00000392828	0.595	G-protein-signaling modulator 1
8	9606.ENSP00000438204	0.586	Mitochondrial import receptor subunit TOM5 homolog
9	9606.ENSP00000315011	0.582	Endothelin-1 receptor
10	9606.ENSP00000267294	0.572	Zinc finger protein ZIC 5
11	9606.ENSP00000439937	0.558	Homer protein homolog 3
12	9606.ENSP00000281321	0.529	POU domain, class 4, transcription factor 2
13	9606.ENSP00000384222	0.528	Protein WWC2
14	9606.ENSP00000283309	0.524	FERM domain containing 1
15	9606.ENSP00000470746	0.523	Zinc finger protein 841

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0050789	0.985	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0023051	0.971	regulation of signaling
GO:0010646	0.970	regulation of cell communication
GO:0008277	0.961	regulation of G protein-coupled receptor signaling pathway
GO:0051179	0.690	localization
GO:0051641	0.513	cellular localization
GO:0051234	0.479	establishment of localization
GO:0008104	0.466	protein localization
GO:0045184	0.448	establishment of protein localization
GO:0051668	0.356	localization within membrane
GO:0090150	0.349	establishment of protein localization to membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0032991	0.999	protein-containing complex
GO:0005886	0.998	plasma membrane
GO:0005938	0.985	cell cortex
GO:0043226	0.935	organelle
GO:0043229	0.680	intracellular organelle
GO:0043227	0.634	membrane-bounded organelle
GO:0043231	0.306	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]